1. Browse the Database
  2. View Redoxidase
Entry information : CbraTDX01 (g30929/CHBRA371g00080)
Entry ID 14209
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-04 (Christophe Dunand)
Peroxidase information: CbraTDX01 (g30929/CHBRA371g00080)
Name (synonym) CbraTDX01 (g30929/CHBRA371g00080)
Class Thioredoxin Type TDX    [Orthogroup: TDX001]
Taxonomy Eukaryota Viridiplantae Streptophyta Charophyceae Characeae Chara
Organism Chara braunii    [TaxId: 69332 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CbraTDX01
start..stop		 S start..stop
KflTDX02 103 2.19e-26 98..177 415..494
HaTDX01 100 8.53e-26 57..181 226..363
KflTrxH02 94 2.46e-25 88..177 21..110
KflTrxH03 90 4.7e-24 88..177 18..107
Gene structure Fichier Exons►


exon

Literature and cross-references CbraTDX01 (g30929/CHBRA371g00080)
Protein sequence: CbraTDX01 (g30929/CHBRA371g00080)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   181
PWM (Da):   %s   20434.7 Transmb domain:   %s   o4-21i
PI (pH):   %s   9.99
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSECRVVPASRPLRYHVPRTAGWCVACALLAYSPWLRPLTSKCRKRMLLGSDNRKKRKNKATRRKQHIVKPLQEATELVEAEHMALGESLTIEDSHCLTVAWFTATWCGPCRQITPVVTK
LNNDYPLVKFLKIDVDENQDLALSEGIQSVPTFRFIKAGRQVSEIKGANALSLEATVKMWA*

Retrieve as FASTA  
Remarks
DNA ►
Send to BLAST
CDS►
Send to BLAST