1. Browse the Database
  2. View Redoxidase
Entry information : KflTrxM01 (Kfl_002370110)
Entry ID 14210
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-04 (Christophe Dunand)
Peroxidase information: KflTrxM01 (Kfl_002370110)
Name (synonym) KflTrxM01 (Kfl_002370110)
Class Thioredoxin Type M    [Orthogroup: TrxM001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflTrxM01
start..stop		 S start..stop
PpaTrxM03 185 2.7e-60 90..195 83..188
PpaTrxM01 184 1.1e-59 66..196 50..190
PpaTrxM02 180 3.54e-58 90..195 82..187
PpaTrxM04 179 7.74e-58 62..195 57..190
Gene structure Fichier Exons►


exon

Literature and cross-references KflTrxM01 (Kfl_002370110)
Protein sequence: KflTrxM01 (Kfl_002370110)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   196
PWM (Da):   %s   20696.68  
PI (pH):   %s   9.6
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAIAAPSAAAFSSLVSASAASSTCGRQATYRACPYSRALPARHNGLSAMQLPSTKMHSQKFRPVAPCRAKVVAEAKSGARVQDPCAEGVTGVVSDKTWDELVKSSKVPVLVDFWAPWC
GPCRMIAPLIDELAKDYKGKLLCLKLNTDESPSIATEHGIRSIPTVMIFKGGKKLDTVIGAVPMTTLTTTVEKFLE

Retrieve as FASTA  
Remarks
DNA ►
Send to BLAST
CDS►
Send to BLAST