Entry information : KflTrxH01 (Kfl_000030040)
Entry ID 14216
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-04 (Christophe Dunand)
Peroxidase information: KflTrxH01 (Kfl_000030040)
Name (synonym) KflTrxH01 (Kfl_000030040)
Class Thioredoxin Type H    [Orthogroup: TrxH004]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflTrxH01
start..stop
S start..stop
KflTrxH03 108 9e-32 49..153 3..107
PpaTrxH09 108 9e-32 50..156 2..107
PpaTrxH01 108 1e-31 50..156 4..109
ThasTrxH02-1 107 7e-31 32..155 4..128
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28452..28454 3 N° 2 28685..28771 87 N° 3 29258..29308 51 N° 4 29654..29783 130
N° 5 30152..30357 206  
join(28452..28454,28685..28771,29258..29308,29654..29783,30152..30357)


exon

Literature and cross-references KflTrxH01 (Kfl_000030040)
Protein sequence: KflTrxH01 (Kfl_000030040)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   158
PWM (Da):   %s   17684.95 Transmb domain:   %s   i7-29o
PI (pH):   %s   7.87
Sequence 199
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVCVACLYPLVIPFAIMFPRIFIGLWNFIQHFFASLFGYDLPAAETEVQDHGRVEEIRSKFEWDSKLRSAGTTPVVVDFTASWCGPCKTIAPTYYALSSKYEHVKFLKVDVDKVPEVAEEAGVRSMPTFHIYKGGKKVDGMVGAMKFQLEAMVKRCAY

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTGAGCACTGAATCTGCATACGCACTGCAGTGGCAAGGTCCTTTGCTTGGACAAGGCTCGTTGATTGCAGAGCTTCCAGTCATTTGCTTCGAGTATCTTTGTATGGTCATATGCCTCT
GCTTCGTCTTCTATTGCTGTGCTTATGCACTTTCAATGTAAGCTGAAAACTCAACTTTGTCTATGAAAGGAACTAATCATCGACTTGCTTGTCATCTTCCTCTGCAAAACAGGTCTGCGT
GGCGTGCTTGTACCCCCTTGTTATCCCTTTCGCGATCATGTTTCCGAGAATCTTCATTGGACTGTGGAACTTTATCCAG
GTAAGAGTGGACCCATTCATAGCACCACCATCTCATGCAGC
TTGAGTCAGCAAATTGAGCAAACGGGGTTCAGACGGATCCACTGGCAGTAAGATGATGTGCCAGTGGGCAGAGTGAAACTTGGAAATTTCCTTGTAGAAAGTAGGGTCTCGAAGATAGAG
CAATGAAGCAGTCTGTCCTGGTCGCAAAAAGTCTGATTGTGCTGCGTTCATTGAGAGGCCTTGCCTCTGTGCGTATGGATCACTCTCTAACCTTGTCACTCAGAAAGTACCAAATTGTTG
CAAACGTTTGATTCTAAACATGGAGATTAGCACAAGCGGACAGGGGCAGGGGCAGTCAAAGCATAACATTGGGGGGCTGTGGTTGATTTCAATTGTTTACAAGCTCGCTGCACTCACTTC
TGTGAACCACCCCAAGAAGAGCTTCAATGCATCTGCACAATGCTTCAATGCTTCAATGACAAAGTGTTATGTTTCTGTGATGCAGCACTTTTTTGCCTCCTTGTTTGGTTATGACCTGCC
GGCAGCTGAGACAGAG
GTCAGATCATCATCCTGCTCAAAATCCTCACATTGAGAGTTGATCAGGGGCCACGTATCTTTATTGTGTGAACCCGCCACGACTTGCAATTCTTTCAATCATGC
AAACATGCTACACCTCAAGTCTCTTGTATTTGTGACGTTGAAGGTTGCATATTAGTTTATTTGTGACGTTGAAGGTTGCATATTTGTTTAGCACTGGCCACCGCAGTGATGCAGAGAAAC
GTTGTTGCACACGTTGCAATTGTAGGTATCGTCCTATGGACCAGTTTCCCGCATTGGCCTTTTGTTGAGGGTCTACGCTGTCCTAGTTTTGGGATTTTGCTGATCCATTCCTGTCGAGCA
GGTTCAAGACCACGGGCGCGTGGAAGAAATCCGATCAAAGTTTGAGTGGGACAGCAAACTTAGAAGTGCTGGGACAACGCCGGTGGTCGTCGACTTCACAGCATCTTGGTGCGGGCCCTG
TAAAACAATAG
GTGAGTGTGCTTCAGCTTCAGATGACGTGAATCTTGGTGGTCTTCCTGCATCTGTGTCTTCCAATCGACCAACGCAAGTCCCTGCCAGCTGGCTGCACCACGTCATACC
CTTGTTCCGTGAGCGATGTTTTGAGGGCTGAAGCTCAAAGTTTCTTGCACCTTGTCCATTTCCACCCTCTGTCTACCACAGTATCTCAAACTGGCCTTGCTCCTCAATCGCCTACAGTAC
TCGCTGACTCCATTGTTGGTTTTGACGGTCAGAAGAAAGTTGTTCCCGTTAGTGACTTCCGGTTTAATCTGCCGTTGTTTGATGGGAAAATGAAAGCTTCAACCAGAGCCTAACGTGCCT
GGGCCCCCTCTCCATCCAGCACCGACGTATTACGCGCTCTCTTCCAAGTACGAGCATGTCAAGTTTTTGAAAGTGGATGTTGACAAAGTGCCGGAGGTGGCAGAAGAAGCGGGGGTGCGC
TCTATGCCCACATTTCACATCTACAAAGGGGGTAAGAAGGTTGATGGAATGGTGGGGGCAATGAAGTTTCAACTAGAAGCAATGGTCAAGCGGTGTGCATATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTCTGCGTGGCGTGCTTGTACCCCCTTGTTATCCCTTTCGCGATCATGTTTCCGAGAATCTTCATTGGACTGTGGAACTTTATCCAGCACTTTTTTGCCTCCTTGTTTGGTTATGACC
TGCCGGCAGCTGAGACAGAG
GTTCAAGACCACGGGCGCGTGGAAGAAATCCGATCAAAGTTTGAGTGGGACAGCAAACTTAGAAGTGCTGGGACAACGCCGGTGGTCGTCGACTTCACAG
CATCTTGGTGCGGGCCCTGTAAAACAATAG
CACCGACGTATTACGCGCTCTCTTCCAAGTACGAGCATGTCAAGTTTTTGAAAGTGGATGTTGACAAAGTGCCGGAGGTGGCAGAAGAAG
CGGGGGTGCGCTCTATGCCCACATTTCACATCTACAAAGGGGGTAAGAAGGTTGATGGAATGGTGGGGGCAATGAAGTTTCAACTAGAAGCAATGGTCAAGCGGTGTGCATATTAG

Retrieve as FASTA