Entry information : KflTrx03 (Kfl_002200160/HCF164-like)
Entry ID 14225
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-04 (Christophe Dunand)
Peroxidase information: KflTrx03 (Kfl_002200160/HCF164-like)
Name (synonym) KflTrx03 (Kfl_002200160/HCF164-like)
Class Other Thioredoxin    [Orthogroup: Trx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflTrx03
start..stop
S start..stop
CbraTrx04 213 3e-68 47..229 208..390
PpaTrx01 206 8e-66 53..229 188..361
ThasTrx06 201 7e-65 39..229 76..259
HaTrx06 196 4e-63 42..229 68..251
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 116795..116872 78 N° 2 117539..117847 309 N° 3 118706..119008 303  
join(116795..116872,117539..117847,118706..119008)


exon

Literature and cross-references KflTrx03 (Kfl_002200160/HCF164-like)
Protein sequence: KflTrx03 (Kfl_002200160/HCF164-like)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   229
PWM (Da):   %s   24600.13  
PI (pH):   %s   4.39
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKGMASRSWRCQSQELDSVEETAEKPDTSEPVFEEEPSPSTSGSSDAEFPAPTKKLNQRLALASVAVAVGMFVATRGAGAGPDLNQLAAGAMQYDAAITNGRPTVVEFYADWCVVCREMAKEVYLAEQNYKDKVNFVLLNIDNKRWAEEVEEYGVGGIPHFVFLDSDGVEEGSAVGKLPRSILEENLAAMARGDKLLPHSGVVGRVTEPGQRPAGFTAPAVVEPRTHG*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAAGGGATGGCAAGTCGAAGTTGGCGGTGCCAAAGTCAGGAGCTGGACAGTGTTGAAGAAACAGCCGAGAAAGTAAGCGGACCAGAAGTTATCTTGTCTCTGTTAAAAAACAAC
AGGAAAATACACAAAGACTCCTGCATTGAGAGCTCTACTCATATGTCTACCAGAATTGACTTTCTAGAAGCTGCCAATTGAGCTCGAAAAGGAGCTTGAATTGCGTTGCTCTGATGACTC
TAAATGCAGCTGGTTTTACTGCAAAGAGACCGCCTGTTTCGCTGTGCCAACAAGATTGTGAGAAATCTCATTGAAGCCAAGGACACTTTGACTTGCAACTTCTATTGTAACGAAGTGGTT
CACACAGTACTTTGATTGTTGACACTTTCAGTAAGCTGCGGCTTCAGCTGCACAAAAGTGGTGAAGCAACGTACCACTTTCCCCATTGAGCCCCAATCTTGGGCCAAAACCACATTCTGT
CCCATCCTTGCTGCGCAACACTCCAAGTTTTCGAGCCACTCCAATTGATTATTGTGCCTCCTCTTGTTATCCTGCACTCTTCAGCGATTGCCCCCGCTCTTGCAGCGCGGCCATGTTTTC
GGTGGCCTTTTCTAGGGGCACCCATTGTCTGTCACTATAGGGCAGGGCAGCAGGATGACCTATTCCAGACCCAATTACTTAAATCCTTATCCTGGTTTTATCCTCACACTAGTTTCTCAA
TTGAGTACGGTCGCTTTTTTGCAGCCCGACACCTCAGAACCTGTATTCGAAGAGGAGCCGTCCCCATCCACTTCAGGCTCCTCCGATGCCGAATTCCCTGCACCCACAAAGAAACTGAAC
CAGCGCCTGGCGCTCGCTTCGGTAGCGGTGGCAGTGGGCATGTTTGTTGCGACGCGGGGGGCCGGTGCTGGCCCCGACTTAAACCAGCTAGCGGCTGGGGCAATGCAGTATGATGCAGCA
ATTACGAACGGAAGGCCGACGGTCGTGGAGTTCTATGCGGATTGGTGCGTGGTGTGCCGGGAGATGGCAAAGGAGGTGTACCTTGCAGAACAG
GTGAGAGGAAAGACGAGGAGTTCGACA
TACTACTGATCAAGTATGGGTTGTGATTGTGGAACTAAAGTGTGTCGATCATGCTTTCATCAACCGGAGAAGCGAGTTGGTCTTATCTGCTTGTTTTGTGCAGTTTTTTAGCTGAAGTGC
GAGCCTTCGTTCGGACATCGGCAGTTTCTGGTCTCAATTCTGAGCATCCATCTGAATGGCTACCTTTGGTACAACGAAAAGCGTGGGGTTTGATGGCACAAGGGACCTCGTTTCGAAAGT
CGTTGTATTCGAAACATCCTGTTCTTGAGGCCAACACAAACTATATTGAATGTGAAAGCAGGTGCAGTGTTTTGATGTCAGGGGCCCTTACAATATCCCTTGTGGATCTTCTTCGCTACA
AACTTCCTCTCAGTCGTCGCCCTAATGCGGTCCTTGTCTCATATCAGGACCGATTCTCATCTGAGTTGATTCGTTGGAATGCACCTCGATCTTTTGTTGGTTCCGAACATTTTGCACTTG
TACCCTCCGTGAAGAAGGGCCCTTTTTGAGACAACGATTCCCCTTGGAACTTGATACTCGGGTCATGACTTACAAGGTTTCAGAACATTGTATTCGAGGGTCCGAGCGAATTAAAGCTGA
TGCTGGCATGTCATTCCTGGCCAGGAGTCGGTCTGCTCGCTTTTATCACGCGACTGGTACTGTTGGGAAATCAAGGAGACAGACAATCGAGACAATTGAACCTATCACACCGGAAATCGT
TCAAATATGTCAGCTCTGTTGCCTACGAGCAGGACGGCAAGTATTACTTGCTGCCGATACCGCAGCCTTTAACTTGGTTGCTCGAATCTATCCGGATCCTCTTCTTTGCAGAACTACAAA
GACAAGGTAAACTTCGTCTTGCTCAACATCGACAACAAGCGCTGGGCGGAGGAGGTGGAAGAGTACGGCGTCGGGGGGATCCCCCATTTTGTCTTCTTGGATAGCGACGGGGTAGAAGAG
GGGTCCGCAGTCGGGAAGCTGCCCCGGTCAATTCTAGAAGAAAACCTGGCAGCCATGGCTAGAGGGGACAAGCTGTTGCCGCACTCAGGAGTTGTGGGTCGTGTTACTGAACCGGGGCAA
AGGCCGGCGGGGTTCACGGCTCCTGCAGTGGTTGAACCAAGGACGCATGGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAAGGGATGGCAAGTCGAAGTTGGCGGTGCCAAAGTCAGGAGCTGGACAGTGTTGAAGAAACAGCCGAGAAACCCGACACCTCAGAACCTGTATTCGAAGAGGAGCCGTCCCCA
TCCACTTCAGGCTCCTCCGATGCCGAATTCCCTGCACCCACAAAGAAACTGAACCAGCGCCTGGCGCTCGCTTCGGTAGCGGTGGCAGTGGGCATGTTTGTTGCGACGCGGGGGGCCGGT
GCTGGCCCCGACTTAAACCAGCTAGCGGCTGGGGCAATGCAGTATGATGCAGCAATTACGAACGGAAGGCCGACGGTCGTGGAGTTCTATGCGGATTGGTGCGTGGTGTGCCGGGAGATG
GCAAAGGAGGTGTACCTTGCAGAACAG
AACTACAAAGACAAGGTAAACTTCGTCTTGCTCAACATCGACAACAAGCGCTGGGCGGAGGAGGTGGAAGAGTACGGCGTCGGGGGGATCCCC
CATTTTGTCTTCTTGGATAGCGACGGGGTAGAAGAGGGGTCCGCAGTCGGGAAGCTGCCCCGGTCAATTCTAGAAGAAAACCTGGCAGCCATGGCTAGAGGGGACAAGCTGTTGCCGCAC
TCAGGAGTTGTGGGTCGTGTTACTGAACCGGGGCAAAGGCCGGCGGGGTTCACGGCTCCTGCAGTGGTTGAACCAAGGACGCATGGTTAG

Retrieve as FASTA