Entry information : HaDHAR02 (HanXRQChr04g0116551)
Entry ID 14238
Creation 2016-11-28 (Christophe Dunand)
Last sequence changes 2016-11-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaDHAR02 (HanXRQChr04g0116551)
Name (synonym) HaDHAR02 (HanXRQChr04g0116551)
Class Dehydroascorbate Reductase    [Orthogroup: DHAR003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaDHAR02
start..stop
S start..stop
HaDHAR14 366 2.45e-130 1..187 1..195
HaDHAR15 324 2.17e-113 22..186 62..226
ThasDHAR02 273 5.08e-93 22..186 69..233
AtDHAR03 266 2.79e-90 22..186 66..230
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14238' 'complement(join(136973759..136973774,136973956..136974032,136974193..136974285,136974480..136974620,136974721..136974838,136974932..136975075,136975163..136975253,136975989..136976052))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 136975989..136976052 62 N° 2 136975163..136975253 89 N° 3 136974932..136975075 142 N° 4 136974721..136974838 116
N° 5 136974480..136974620 139 N° 6 136974193..136974285 91 N° 7 136973956..136974032 75 N° 8 136973759..136973774 14
complement(join(136973759..136973774,136973956..136974032,136974193..136974285,1 36974480..136974620,136974721..136974838,136974932..136975075,136975163..1369752 53,136975989..136976052))


exon

Literature and cross-references HaDHAR02 (HanXRQChr04g0116551)
DNA ref. HanXRQ genome:   HanXRQChr04 (136976052..136973759)
Protein sequence: HaDHAR02 (HanXRQChr04g0116551)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   247
PWM (Da):   %s   27958.6  
PI (pH):   %s   9.32
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMLNRPLKSYMTKNLRYKSTYCPFTQRVLLTLEEKHLPYGLKLVDLGNKPAWFLSISPEGKVPVAKVDDKWIADSDVITQTVEEKFPDPSLVTPPKKASVGSKIFSTYIGFLKSKDANDG
TEKALLNELSAFNDYIKE
GPFINRKDISAADLSLGPKLYHMEIALGHYKKWSVSDSLPHLKIYMKIGPDHQTLYWSATWPKEVEQLARQLLYNPCKVVIGSSELKANHSIHQHVDIMTEN
Q
KLINA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGTTGAATAGGCCATTGAAGAGCTACATGACAAAGAATTTAAGGTATAAATCAACTTACTGTTATCTTTATGAATGCTCACAAGGATTATTGCAATTGTTTTTTTTTTTTTTAATT
TCTCTGTTTTTGAATATAAACGCTTAATGAGGTTATTGCTGACCCATTTACGTATAAATGGGTCGATTTGGGATATCTTCTATTTAACGGGTCGACGGGTAAACACTAAAACTTCACTAA
AAGGAAAAGCAAAATAAGTATATATACACACACACAACATATATACGATTTTTTACGTTTTTAGGTTTGAATTATGTTCTCGGCCCATATTGTCGACTCCTATATTTTTTGAAACATTTG
TAAAAACACTGATACCATTTGTTGCTATCAATGTCATCTTTCGGTTATATCACGGAGTTCTATCAACTTCATAAATCAATTTCTTTGAGTTTGAATAATCAAAACCAAGTTAATACACAC
TAGAAAAAAATAAATATACATTGATATTAATTCAAACCTAAATACGTTAAAAACGTTAAAAAATCTCCCATATTGTGCGCTTGTGATCAATATTGCCAATCTTTTACATGCAAGTTTCTT
TTGATTTTTAGTGTGGATATTCTAAACTAAAGTCTAATAGCATGTAGTTTAACATAAACGATTAGGAATGTTCATGAGCCAAAATGAGCCAAGCCATGGCTATTCAGGCTTCGCTTGTTT
GTAAATGAGCTAAGCCGAGTTGTCTTAGTTTATAAACAAATTTGGGTGCACAGTTATTTTTATATATCTGTTGTTTCAGGTGTCCGTTTACACAGAGAGTTCTGCTGACACTGGAAGAGA
AGCATCTTCCTTATGGCCTAAAGTTAGTTGATCTCGGTAACAAGCCAGCCTG
GTAATCATACAGTATTCCGTTTATAACATGTCGTGTTTTCAACCGTTCATAATATGATCTACGCATGA
CACTCTTGGTTTTACGTAGGTGTTTTTAAGTATTAGCCCAGAAGGTAAAGTCCCAGTGGCGAAAGTTGATGACAAATGGATAGCAGATTCCGATGTTATTACACAGACAGTAGAGGAAAA
GTTCCCCGACCCGTCACTGGTGACCCCACCTAAGAAAGCTTCTGT
GTACACTCATGCTCTTTGTCTCCCCTTTGTTCAGTTTACATTCATTTTTGCAAATTGATGTTGAATAATGGTATT
TCTGATTCATATATCTAGCGCGGGTCGAAAATCTTTTCGACATATATTGGCTTCTTAAAAAGCAAAGATGCGAATGATGGAACGGAGAAAGCTTTACTGAATGAACTCTCTGCTTTCAAT
GATTACATCAAAGAAAAT
GTGGGTTCTGTTCTATCTCTCCACACACGCACATATATATCAAACTGTTTGTTGAATTAGGTTGCTGATTTTAAATTTTTTTCTCACGTGTTTGTTGAAGGG

GGTCCGTTTATCAACAGAAAGGATATCTCTGCTGCAGACTTGTCGCTAGGTCCGAAGCTGTACCATATGGAGATCGCTTTGGGTCATTATAAGAAGTGGTCAGTCTCAGATTCACTTCCC
CATCTGAAAATATACATGAAG
GTACACTTATCTTTGTTGAATTGCATAAAGTTATCTTTTTGTGAGAGCAGCCTTAATTGTTATGCTCTTTGATTTTTATCTTTTCCATAATATGTTATA
ACTAACAAAATATCATTACTGGTGACTACCCCTTGTATATCAGAAGCAAGTAGAAGAGCATTGCAAAACGTTTCACTAATGTGATTTATGTTCAGATATTGGGCCAGATCATCAAACTTT
GTACTGGAGTGCTACATGGCCAAAGGAAGTTGAGCAACTTGCAAGGCAGTTGCTTTATAACCCTTGCAAA
GTAAGATATTTAATTTAGAAATGTTAAAGTTAAAGGTAGCAATTTCAACA
CATTTTTATGTTGATGGTTCAACTCGGGTTGTATTTCATTGAAAACGTGATACACCAAAAACATAGAAAACTTCATCATGCTGACACATTGTTGTTTGAAATATATACAGGTGTGGTGAT
TGGTTCTTCAGAATTGAAAGCTAACCATTCAATTCACCAACATGTGGATATTATGACCGAAAATCAAAA
GTATAGCAACTAAGTTAAATCATTTTTATTGGTACCAACCAAGATTCTTCA
CTACACTTTGTCAACTCACAAATATAGTTGATTAATTGAGTATTCAGGTTACTTAACGGTTTGTCGGTTAACCTAGCCATTAGTTTTATAACTTTTGTTTTAATAATTAAACCAGCATTT
TTGTTTTTAGATATTGATAAATGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGTTGAATAGGCCATTGAAGAGCTACATGACAAAGAATTTAAGGTATAAATCAACTTACTGTCCGTTTACACAGAGAGTTCTGCTGACACTGGAAGAGAAGCATCTTCCTTATGGC
CTAAAGTTAGTTGATCTCGGTAACAAGCCAGCCTG
GTTTTTAAGTATTAGCCCAGAAGGTAAAGTCCCAGTGGCGAAAGTTGATGACAAATGGATAGCAGATTCCGATGTTATTACACAG
ACAGTAGAGGAAAAGTTCCCCGACCCGTCACTGGTGACCCCACCTAAGAAAGCTTCTGT
CGGGTCGAAAATCTTTTCGACATATATTGGCTTCTTAAAAAGCAAAGATGCGAATGATGGA
ACGGAGAAAGCTTTACTGAATGAACTCTCTGCTTTCAATGATTACATCAAAGAAAAT
GGTCCGTTTATCAACAGAAAGGATATCTCTGCTGCAGACTTGTCGCTAGGTCCGAAGCTGTAC
CATATGGAGATCGCTTTGGGTCATTATAAGAAGTGGTCAGTCTCAGATTCACTTCCCCATCTGAAAATATACATGAAG
ATTGGGCCAGATCATCAAACTTTGTACTGGAGTGCTACATGG
CCAAAGGAAGTTGAGCAACTTGCAAGGCAGTTGCTTTATAACCCTTGCAAA
GTGGTGATTGGTTCTTCAGAATTGAAAGCTAACCATTCAATTCACCAACATGTGGATATTATGACCGAA
AATCAAAA
ATTGATAAATGCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CATTGAAGAG CTATTTTCTG CTTACCGCTA GAATTGCATT TTCTGTGTTT CAGTGATTTT GTGCTTGATT ATTGATGATT GTAACCGAAG ATTCAATGTT GAGTGAAAAT TAAAGACGCG  AATTGAATTT GCCCTATCGT TTCCATTCCC TCATCACAAG GAATACAAAT CATCCATATC ATCAATTCCC TTCGGTTACA GGCCGTAATC GTTGTCATAT CATGATTGAA GAACCTAACA  CAATCGTCAT CTCCCTTGTT GCTGTTGCGT AAGTTTGAAC CAGGAAAGGA GCTCGGGTTG ATCAATCGCA GGGTAACCGG GTGAAGAAGA CGACCGGTAA ACCAAACCAC GTGCACCCGT  TTCAGCTGAG TTCGAGTTAC AGTCCAAACT TCAGGGTTAA AATCCGGTTC TGTCTCTACA AACTTGGCTT CGGTTCTGAG TAGCAGGCCA CCGTTTCAAG CTTCTTATTG TGTATTCATC  TACCAGATGA TTGAAAGTAG CCAATGTGGG GATAATTTGG AAGGGGAAGT AACATTGTCA CAGCTGGATT TTAAATGACG TGGCAGGATC TGAAAGTTCT AAAACAGAAC CAAACTGGAA  TGAGGAGAAG AGGTTGTGAT TATTGGTTTC AATTGCAAAT ACCGTATCTG GAGTCGATTG ATTGGTTAGC TGGTCGCTAT GAAGAATTGC TCTTACCCAA AAGTGGAAGG TTTCGAGTGA  ACTTTGTGAA CCATTTTGGG GTGTTGAGGT GAGGTTGGTA ACAAATAAGG ACACTAGCAT TCAGAAGTAA AGATGATGTT GAATAGGCCA TTGAAGAGCT ACATGACAAA GAATTTAAGG  TATAAATCAA CTTACTGTCC GTTTACACAG AGAGTTCTGC TGACACTGGA AGAGAAGCAT CTTCCTTATG GCCTAAAGTT AGTTGATCTC GGTAACAAGC CAGCCTGGTT TTTAAGTATT  AGCCCAGAAG GTAAAGTCCC AGTGGCGAAA GTTGATGACA AATGGATAGC AGATTCCGAT GTTATTACAC AGACAGTAGA GGAAAAGTTC CCCGACCCGT CACTGGTGAC CCCACCTAAG  AAAGCTTCTG TCGGGTCGAA AATCTTTTCG ACATATATTG GCTTCTTAAA AAGCAAAGAT GCGAATGATG GAACGGAGAA AGCTTTACTG AATGAACTCT CTGCTTTCAA TGATTACATC  AAAGAAAATG GTCCGTTTAT CAACAGAAAG GATATCTCTG CTGCAGACTT GTCGCTAGGT CCGAAGCTGT ACCATATGGA GATCGCTTTG GGTCATTATA AGAAGTGGTC AGTCTCAGAT  TCACTTCCCC ATCTGAAAAT ATACATGAAG ATTGGGCCAG ATCATCAAAC TTTGTACTGG AGTGCTACAT GGCCAAAGGA AGTTGAGCAA CTTGCAAGGC AGTTGCTTTA TAACCCTTGC  AAAGTGGTGA TTGGTTCTTC AGAATTGAAA GCTAACCATT CAATTCACCA ACATGTGGAT ATTATGACCG AAAATCAAAA ATTGATAAAT GCTTAATGAG GAAGGTCGAG TGGATGTGGG  ACAAGTGACA CTTACAACTA CACGGTACCT GTCGGGTCGA AACGGTGAGA GACATGTGGC GATGTTACGA GTTAGTGCGT TTCGACGACG AACCGGTGGC ATATGGCGGA GTTGCAATCC  GTCACACATC ATGCGAGGCG GAAACGGAAA TTGACAAACT CGAAAGACAT ACCCTTCTAC TGAAACATAA TATATTAGTG AATTGGTAAA ACGTTATATA GAGCTAGCAG GGCCAACCCT  GAGAATTCGT GTACCATGTT CGAGCTCGAA AAAACGTGCC CTTAGGTGGA GGAATGTGGA GAGCTTTGAG TTTGATGAGG AAGAACTTAA ATCTTTCAAA CTCTTTTTGC TTTGACAGTA  TTTGTTTTTG TTTCATATAA GTTAAGTTGG TTCTTTAATA TGTACTCTTT TCTATCATTC ACATGTTATA TGTATTTGAT CATGTAGCAG CAACCCGATC AGTATCCAAA GAAAGAGCCA  AGATATAGAA TAAAAGGTCA AAGCTCAATT GAGCCTGGTC TCTCAAGTTG AGAGTCAAAA TTGTTGGGCG GAATGATTTG AAAAACTTGA TGTCCAAATT CTCTTATGTC ATTCGTTTTA 
AAAATATACC CAATCACCCA ATGTTCATGT AGTATTACTT GCCCTTTTGT ATTTGTACAC ATAGAGGTCG AAATTTCAAT TCTATTTTTG ATTGGGTTGA TTATGGTTGT CTTT 

Retrieve as FASTA