Entry information : HaGR01 (HanXRQChr01g0022211)
Entry ID 14245
Creation 2016-11-28 (Christophe Dunand)
Last sequence changes 2017-11-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGR01 (HanXRQChr01g0022211)
Name (synonym) HaGR01 (HanXRQChr01g0022211)
Class Glutathione Reductase    [Orthogroup: GR001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGR01
start..stop
S start..stop
HaGR03 918 0 5..493 1..487
AtGR01 844 0 1..497 1..499
ThasGR01 840 0 1..497 1..493
LeGR05 764 0 49..497 7..454
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 126158147..126158290 144 N° 2 126159488..126159552 65 N° 3 126159707..126159776 70 N° 4 126159941..126160012 72
N° 5 126161637..126161840 204 N° 6 126161953..126162026 74 N° 7 126162621..126162704 84 N° 8 126162775..126162862 88
N° 9 126163572..126163653 82 N° 10 126164015..126164088 74 N° 11 126165192..126165299 108 N° 12 126165407..126165471 65
N° 13 126165572..126165685 114 N° 14 126165761..126165860 100 N° 15 126165956..126166009 54 N° 16 126166104..126166199 96
join(126158147..126158290,126159488..126159552,126159707..126159776,126159941..1 26160012,126161637..126161840,126161953..126162026,126162621..126162704,12616277 5..126162862,126163572..126163653,126164015..126164088,126165192..126165299,1261 65407..126165471,126165572..126165685,126165761..126165860,126165956..126166009, 126166104..126166199)


exon

Literature and cross-references HaGR01 (HanXRQChr01g0022211)
DNA ref. HanXRQ genome:   HanXRQChr01 (126158147..126166199)
Protein sequence: HaGR01 (HanXRQChr01g0022211)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   497
PWM (Da):   %s   53343.51  
PI (pH):   %s   6.78
Sequence 538
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRKMLNDGGVGSGGESEDNQYDFDLFVIGAGSGGVRASRFSAQYGAKVGICELPFHPISSETIGGVGGTCVIRGCVPKKILVYGATFGPEIQDSREYGWKVNETVDFDWKKLLHKKTDEIVRLNGIYKRLLSNAGVKLFEGEGRIVGPNEVEVIQLDGTKLSYSAKHILIATGSRAQRLDIPGQELAITSDEALSLEELPKRVVVLGGGYIAVEFASIWRGMGSTVNLCFRKELPLRGFDDEMRALVARNLEGRGIILHPQTNLTQLVKTADGIKVTTDHGEELMADVVLFATGRIPNTKRLNLQAVGVEVDSIGAVKVDEYSRTNVPSIWAIGDATNRMNLTPVALMEGTMFAKTVFGNEPSKPDYSNIPCAVFCIPPLSVVGLSEEQAIAQAKGDILVYTSTFNPMKNSISGRQEKTLMKLIVSAETDKVIGASMCGPDAAEIMQGIAVALKCGATKAQFDSTVGIHPSSAEEFVTMRSVTRRIAAAGKPKTNL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTCAAGGAAGATGCTGAACGATGGAGGTGTGGGAAGTGGTGGTGAAAGTGAAGACAATCAGTATGATTTTGATTTGTTTGTGATTGGTGCTGGCAGTGGTGGTGTTAGGGCTTCCAGAT
TTTCAGCTCAGTATGGAGCTAAG
GTAACAACATTTTATTGCTTGAATGTGTGTGTGTTTTGTTTAGTTGTTTATCGGTCGGTCAGACGTTGGTGGAATCCGGTTTACTGGCTGGGGGTGT
GGTTTAAAGCCCTAGGGGCCTTATAATCCACGTCAGATCCACATCAGCGCCATGTCACATATGGGGCTTTAAAGCCCCTCACTTTAACTTGCATGCAATGGTTTAAAGCCTCTATTAAAC
AAAATAAAAAAAACAAAATATTTGATTGGTTGATGGTTTAAAGCCCATCCGCACACACCCTTTAGCGCTTGTTAGTGTGCTGGCGGGCCATCAATGGCGCTCCCTCTTTGGTGGGCAGGG
GTGGCTGAGGGGCGCTAACGAAGGTGATGTGGCCAGGGGCGGTATACCACACCCCCTGGCCTTAGTATTGATATAATTGAATTACTGGTGGCAAATTATATATATGTATTTTTGTTTTAA
CTAATGCTTTTTGTCCTCAATAGATTCAGTGATGACTTCCATTTGATTGTAAATTATAGATATTGTAGTAATTTCTGTAGCTTGTTATGAGAATAGTAAGGTTTAGAAGTACGGAATCGT
GCCTCGAGGCGTTTTCCTTTCGCCTCACGAGGCGTACGCTTCAAGACGAACCGAGGCGGAATTAAAAAATGAATATAAAATCTATATACTGTATCTTATAAATTATAAAATTATAAAATA
CTTACTAATCTCATCATAAGATTCATCAAAAACACACACGTTAAAAAGACATGGAATGTTTAAAATTGACACAAAAAGTCTAAAGCATCGGAAACAAACACCAAAATTCAAAACCCCCGC
CCCCGAGGCACTGTTTTTCTTACCGCCTCAGCTCTATGAGGCGCACATACAAAATACCCCCCTGAGGCGCTGTCTCGTACTCGTTTTTTTGGGCGACTTGGCCGTTTTTTAAACTATGGA
GAATAGAAGTGTTTACCAGACGCAATATATATGTACGTTGAAGTTTTATCCAGCATTTTATTCAACTTGTGGTGAAACATGAACCCTTAACATGCACTCATGCCAAAAAATAGTGTATTC
AATAACATGTGATTTAACAACAGTGAACGACCTTTGATGATTTATCTTCTAGAAGTCTGTTCATGCTAATAATTGTAGTTAGTAATATCTACCAGATGATTTGTTCTATTATTCATCTCT
TCTACAAATCTTATTGCAAGGTTGGGATTTGCGAGCTACCATTTCATCCAATCAGCTCAGAGACTATAGGAGGTGTTGGAGGAACGTAAGTTTTCCGATAATGTTTAGCATGGTACCGTT
AATGATGTATTATTTATTTAAATATAATTCATAATTTCATATCTCTCTGGATATTATTTTGGGATGGTTAAGAATCACACAATTTAGTGGTGGATGTATAATGTTTACATGTGATGCAGG
TGCGTGATTCGTGGGTGTGTTCCTAAAAAGATTTTGGTCTATGGAGCGACTTTTGGGCCTGAAATTCAG
GTGATCTTGAGTGGAAATCACAGAAGTGGATGATGTCTAATGTTATGAATT
TTTTGTTTTAGGTTTATTTTGTGCTGTTACTAATTCAGTAAAGTTATTAATAGCGCTCGTGGCGAGCGCTATAGCGAATTTTTTTTTACTGCTCTCTGTTTCATCTCGTGTAGGATTCAA
GGGAGTATGGATGGAAAGTCAACGAGACGGTTGATTTTGATTGGAAAAAGCTACTGCACAAGAAG
GTTTGCTGTGAAAAATATATTTCGCCATTTTAGTTTCTTTTTCAAGTTAATGGGG
TGGGTATAAGTAATAACCTTTAGCAACTACTATCGTCAAATTCTAGCCATTATGTGTTTTTCTTTTCCTTCTAACAAGAACTGATATGTACTCAACGGATAAAATATTCATTCACAAATC
CCTCGGTATGTGGAAAAGATGAATCATACATGTTGAATTCTTATAAAGATTATTGCAGGATGTAAATTGGATAATAAGATATATCTTGAGCGTTAATTTTTTTAACAAATTTTATCTTCT
ATTTTAAAATGTGATTTGAGTCTCTTATCTAGAAGCAAGGAATTAAATGATCATCAATCTTTATGTACTGATATTGTTATTCTTTTTTTCTTCTTTTATGTGCACATTCTGTCTTACACA
TGTGTTTAGCTGCTTCAATTAAATGTTATATTTTCATCAATGTTACTTTTTAGTTCCTATGACATTAGCATTAATGGTGTTTCTACAAAGCTTATAATTTTTAACTTACATGCTTGTTTT
TTGGCATTTTTTTATTCCAAATTAAACGGGCCTTAAGAGTGTTTTGGTTTTGGAAGTCAACAACTACATCCAATATTCTTAGGTGTTCTAAAAAGCTGACATTTGTCGTTTTTCTTCTCA
TGATCATCTTGAGCCAATCAAATGAGTGTCTTTAGTCATCACACCTCATGCATCTAAAATGTAGTTTATTATATGTTTACTAGTTTACTAGCAAAAATGTTCCCGTTATAAGTATCATAG
AATAGTGAATCATTGTCATTCTTTCATGTTCTTCCTTGTTATAACCTGTAAAGTCAATTTAATTCAACATAAAGAAAACAGTTATACACATTGCAGCGCACATGGCTTTTGCTAATCTTA
TAATAATAAATTTTCCGTGTTAATGCATTTAACGTGTTTTTTGTGCTTCTTCATCAATTCTCGAATGCTGTATTAGTAGACATTGTATGCACCTTCATTATAAACCAACTTATGAGCAGT
TCATTTTATATTAATTTAATTTAGAGTAAATTGCCAAAATCGTCCCTGAGGTTTGGGCATGTTTGCCATTTTCATCCAAAACAACTTCTTTGTACCATATAGTCCATTTTTGAGATTTTT
TGCCATTTTCATCCAAACGTCTGACTTTTTTGCCAAAATCGTCCCTGAGATTTGGGATTTTTTGCCATTTTCATCCAAATGTTTGATAGAAAAAATAAAGCAAACTAGATATTTGGATGA
AAATGGCAAAAAATCCCAAAAGTGAAGGACTATATTGTACAAAAAAGTTGTTTTGGATGAAAATGGCAAACATGCCCAAACCTCAGGGACAATTTTTGCAATTTACTCTTTAATTTAATT
TCAACAAAATTTTAATTTTCTATTATTCTGCATATAATGAATGTGACTAGACAAGCTTTATTATTTCAATCAATAAATCATTGTTGTGTAAACTGATTAGGTTTCACGTCCGTCTACTTT
TCTAATAAGCTATTTTTGCTTTATTGTTACTCATTTGAAATCGGCCAATTCATAAGTACATGGTTGAAAGTGCCACTTCTTTTTTTTTTTTTTTTTTTTTTTATTATAACATCTTTGTTT
TTATATTAGACGGATGAAATAGTGAGGCTAAATGGGATATACAAACGCTTACTTTCAAACGCGGGAGTCAAACTTTTTGAAGGGGAGGGAAGAATTGTGGGGCCGAATGAAGTGGAAGTC
ATACAATTAGATGGCACCAAATTGTCCTACTCAGCAAAGCATATACTCATAGCAACTGGTAGCAGGGCTCAACGTCTAGATATCCCTGGACAG
GTAAAAAAATAAAAAAAAAATTTAGAC
AAAATTACTTCCTGCTGAGAAATTAAGCAGTTGGTTTTTTAGTTTAAAACATAATATTGTATTTACTTTTTTGTTTATGATCTAGGAGTTAGCTATAACATCTGACGAGGCTTTGAGCTT
GGAGGAGTTACCAAAGCGCGTTGTTGTACTTGGGGGAGG
GTATGGTCACTTATGACTTTTCCATCTAGTTTGGTTTTAAATTACGCGCATCAGGAGCGCGTAATGCGCGATGCGCTGATG
AGACCGCATCAGGTGATGCGATGCACTGCGATTACCTGATGCGCTCGCATGATGCACACGTTTTTTTTTTTTTTTTTGAAAATGACCACTATATAGTAAAATGGTACAATGTGCTTAATA
AGCTTGTACAATGAGCTGATGAAGTTTTTAAGTGAGTTCCTACACAGATTACTTGTACCTTTTGCATAGATTACTTGTACACATAAGAGCTCAAGGTTTATTTTTGTTATATTGAATTTC
TTTGATGTTGTTAGAGCTATTTTTTTATTTTAATCTCTAAATTTTTAGTATTTAAAGTTCACAGGTTGAAATATTATCTATAAATAATTTTTTAAATAACAAACGCCTCACATACGTGAT
GCGTGCGCATCAAGCATTGTGCATCGGCTTTTGGGATCAAAACGCATTGGAGCGCATCACACATTTTAAAACCAAGCCATCTAGTAATTTCTTGTTTATGCGCATTTTCAGTTTATGATC
CCCACAAGATGACTAATTCTTGTATCCTATCAGGTATATTGCGGTTGAGTTTGCTTCAATTTGGCGTGGGATGGGTTCCACGGTGAATCTATGTTTTAGAAAGGAACTTCCTTTAAGGTT
ACAGTTTTTTAATTAAATGCATAATAAACTTCGTCTTGATGAAATTACCAAATTGACATCATTACAGGGGTTTTGATGATGAAATGAGAGCTTTGGTTGCAAGAAATCTTGAAGGAAGAG
GCATAATTTTGCACCCACAGACAAATTTGACACAG
GTTTCTTACTGTTTTAGGTTAATTTGTTATTGATTATATTTGTAGGTAAAGGATCAAATAAAAATAAAATTAACGTACGAAACGT
ACGAATTGAAAGAAAAGTCAAAAAGTGGCGGTGGCAATCTGGTAATTATCAGCAACTTCAAAAAAGCAAAAAGTATCGGTGGCAATCTGGTAATTATCAGCAACTTCAAAATTACTCTAG
TAGAGTAATTTTGAGCATCTGTAGAGTAATTTTGGGAAATGTAGGGTAATTATCAAATTACTCTAGTAGAGTAATTTTGACTTCTGTAGAGTAATTTTAGAAAATGTCTTGTAGAGTAAT
TTTGTTAGCATTTAGTTATGGGGTTTAGCTTTATGGTTTAGTTTTTAGCTTTTAGTTGGGGGGGGGTTGGTTTAGGTTTTGTTTAGGTTTTTTTTTTTTTTTTGGGGGGGGGGGGTTAGT
GTAATTTTGATAATTACCCTACACGACCAAAATTACTCTACATGAACATTTACAAAATTACTCTAAAGAAGCTCAAAATTACTCTACTAGAGTAATTTTGAAGTTTCTGATAATTACCAA
AATGCCACCGCCACTTTTTTGACTTTTCTTTCAATTCGTACGTTTCGTACGTTTATTTTATTTTTACGGGAACTTAACTCTATATTTGTATCGCTAAACTTTCTTGAATCTTGAATTGAT
TTAAGTTAAATGTATATGTTTCAGCTGGTGAAAACAGCGGATGGCATTAAAGTTACTACAGATCATGGTGAAGAATTAATGGCAGATGTTGTACTTTTCGCCACTGGTAATTCTATCTTC
TCATAAAGATAGTCATTATAGTTAAATGTCAAATTTTCTTTATTTATATTTAAATGATTCGAATTTTCTATAGGGTTGTATAAGATCTTATAACATCAAGTTAAGCAAAATATTAGCATC
TCAGGTTTTATCCTATACATTTTAACAGTAAACTTTTTATCCTGAAATAGCATGTCTTGATTTCTTCATGATTATGGGTTAACAAATAAACAAATGACAAATCGTTCTTTTCTTACTTAA
GTGTGAAACTTTGCTATATGATCACTCTACATTCATGCTTATATATTGTAATTTTTTTCAAAATTACTAAATTAATTAACAAGTATTTATTTTTTTGTTGGTTGCAGGGCGGATCCCAAA
TACAAAGAGGTTAAATTTACAAGCTGTAGGTGTTGAAGTTGACAGTATAGGAGCAGTGAAG
GTTCTTTTAAATTTTTATTAAATCCTTTTACTTTATTTCCCTAATTTTTTATGATGTTT
GGAATGTGTAGGGGTGAGCAAAAAATGATTAACTGAACGGAAACCAAAATAACTGACAAAAGCGCACCGAAATAACCGATCCAAACTAATAACCTACATTTCAGTTTTGTTTTATCAACT
GAAAATTACTGTTTGGTAATACCTTGTTTTAAAACCGAACTGAACTTGGAAACCGAACCACACCGAACTTGTTTGAATGTTTTTTATTGGCTTTACGGCCCCAATATTTTTAATAAGTGG
TTAACAAAAAGTTTAGGCCAAAAGGTCTAGGGTCTAATTTATTGATTTGGGCCAATGTTTTTCAGGCCCTTATGTAAAACCGAAAACTGGCCCATAACCGAACTGAACTCATACTTAAAA
CCTAAAAACTAGAGATGGGCATATCAGGTTTTTTTTTTTGTACCCGGAACCGGTTCCTAACCGGACCCGGTTCTTGTTAGAGTGTGTGGGAACCGGTTCTTGTAGGAACCGGGTCCAGTT
CCTAACCGGGTTTAGAGCTTTATTACTGGAACCGATAGTAACCGATTCCGGGTAGGGTTGGAACCGGTTTCTTTGAAGAACCGGTTCCACCGGGTAAGTCCTTAAAATCACTTAAATTGT
TATTGTGGAATCGGTTCTTAAAAAAAATTCCTTATATTGAATAAAATACTACAATTTTAAAAAACATAAAAACATATTAAGAAAATACAAACATACTGTATTGGAGTCCTTGCTTAACAA
AGCTTCACAATGTTTGCATTGAGCCTTTTGCGAGCCGTCATTCATTTCCACCAAATCCCCAGTTGCACCGGGTTCTTTTTGTTTACGAAGGAACCGGTTCTGGGTAGGAACCGGGTACGA
CCCTATTTTTTTATAAAATGTGGAACCGGGTAAGAACCTACGGGTTTTTTGAACCCAGAACCGGTTCTTCTATACAGCGGGTAGGAACTGGAACCGGTTCCTGGTCGGGTTTGGAACCGG
TTATTATGCCCATCTCTACTAAAAACTGAAACCAATCGGAATTCTAAAAATGAAAAACAAATACTTATGAATTAAAATTTGCAGGTTGATGAGTATTCTCGCACTAATGTGCCTAGCATA
TGGGCCATAGGTGATGCTACAAACCGTATGAATCTTACACCTGTCGCCTTGATGGAAGGAACAATGTTTGCT
GTATGTGTTTTCAGTCCTCTGTGATTTCTAAACTCTAGTTGTACTCTG
AATTTATTGATTATTTTTTTATTGGCTTCTTTATAAATGTAATTATTGTTTTGACACAGAAAACCGTCTTTGGTAATGAACCTAGCAAGCCCGATTATAGCAACATCCCTTGTGCCGTTT
TTTG
GTAACATATCAATTTTCTGATTTTTATTTTCTTTTCTAGGGATCAGATGTGAAATTCGCTATTTTAAAACGATGTAACAAAATTTCGTATTCAATTTCAGCATACCACCTCTCTCT
GTTGTTGGACTAAGCGAAGAACAGGCCATAGCGCAAGCTAAAGGAGACATATTGGTGTACACGTCAACATTTAATCCTATGAAGAACTCCATCTCTGG
GTAAGTGAACATGTGCAACTTC
TCTGTCATAAAGTAAATGAGACCCACAAAATGAAATTTTTGATGTATCCATAGACGACAAGAGAAGACACTCATGAAGCTTATCGTTAGTGCTGAGACCGATAAAGTTATCGGTGCGTCG
ATGTGTGGGCCTGATGCGGCAGAAATTATGCAG
GTATATTTAATCACTCTTGATGCTTTTAAATGTTGTTTTAGAAGTAATTAGGGTGTAAACAAGCCGTCCAACTTATTAATGTTAATA
TATCATAGGGCATTGCTGTTGCACTCAAATGTGGAGCAACAAAGGCACAATTCGATAGCACGGTGAGCTTAGACCGATTATTTATATAAATAAATATAAATCTCATGATCTTATTTTCAA
AAATGTAAGGACAAATATTACGTTTTCCTTTCTCAGGTGGGGATACACCCGTCGTCTGCTGAAGAGTTTGTTACAATGCGCTCAGTCACAAGGCGTATTGCTGCAGCTGGTAAACCGAAG
ACCAACCTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTCAAGGAAGATGCTGAACGATGGAGGTGTGGGAAGTGGTGGTGAAAGTGAAGACAATCAGTATGATTTTGATTTGTTTGTGATTGGTGCTGGCAGTGGTGGTGTTAGGGCTTCCAGAT
TTTCAGCTCAGTATGGAGCTAAG
GTTGGGATTTGCGAGCTACCATTTCATCCAATCAGCTCAGAGACTATAGGAGGTGTTGGAGGAACGTGCGTGATTCGTGGGTGTGTTCCTAAAAAGA
TTTTGGTCTATGGAGCGACTTTTGGGCCTGAAATTCAG
GATTCAAGGGAGTATGGATGGAAAGTCAACGAGACGGTTGATTTTGATTGGAAAAAGCTACTGCACAAGAAGACGGATGAAA
TAGTGAGGCTAAATGGGATATACAAACGCTTACTTTCAAACGCGGGAGTCAAACTTTTTGAAGGGGAGGGAAGAATTGTGGGGCCGAATGAAGTGGAAGTCATACAATTAGATGGCACCA
AATTGTCCTACTCAGCAAAGCATATACTCATAGCAACTGGTAGCAGGGCTCAACGTCTAGATATCCCTGGACAG
GAGTTAGCTATAACATCTGACGAGGCTTTGAGCTTGGAGGAGTTAC
CAAAGCGCGTTGTTGTACTTGGGGGAGG
GTATATTGCGGTTGAGTTTGCTTCAATTTGGCGTGGGATGGGTTCCACGGTGAATCTATGTTTTAGAAAGGAACTTCCTTTAAGGGGTTTTG
ATGATGAAATGAGAGCTTTGGTTGCAAGAAATCTTGAAGGAAGAGGCATAATTTTGCACCCACAGACAAATTTGACACAG
CTGGTGAAAACAGCGGATGGCATTAAAGTTACTACAGATC
ATGGTGAAGAATTAATGGCAGATGTTGTACTTTTCGCCACTG
GGCGGATCCCAAATACAAAGAGGTTAAATTTACAAGCTGTAGGTGTTGAAGTTGACAGTATAGGAGCAGTGAAGGTTG
ATGAGTATTCTCGCACTAATGTGCCTAGCATATGGGCCATAGGTGATGCTACAAACCGTATGAATCTTACACCTGTCGCCTTGATGGAAGGAACAATGTTTGCT
AAAACCGTCTTTGGTA
ATGAACCTAGCAAGCCCGATTATAGCAACATCCCTTGTGCCGTTTTTTG
CATACCACCTCTCTCTGTTGTTGGACTAAGCGAAGAACAGGCCATAGCGCAAGCTAAAGGAGACATATTGG
TGTACACGTCAACATTTAATCCTATGAAGAACTCCATCTCTGG
ACGACAAGAGAAGACACTCATGAAGCTTATCGTTAGTGCTGAGACCGATAAAGTTATCGGTGCGTCGATGTGTGGGC
CTGATGCGGCAGAAATTATGCAG
GGCATTGCTGTTGCACTCAAATGTGGAGCAACAAAGGCACAATTCGATAGCACGGTGGGGATACACCCGTCGTCTGCTGAAGAGTTTGTTACAATGC
GCTCAGTCACAAGGCGTATTGCTGCAGCTGGTAAACCGAAGACCAACCTCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCATATTTTG GGTACATTTT GCACCGTGTG CATTTCCAGT CCCAAGAGTA CAACACTCAA CTGCACAAGG TACCACAACC AATAAACCAA TCAAACCTTT TCAAACTTTG AACACACACT  GCATTCTCCT CCTCAATACT CGTCTCTCGT GTCACTTTCT CATTCAAAAC CCTACGATTC CGAAGCAAAT CAACCTCTTC ATTTCTTCAC CAACAACTAA AAACCCTTGA TCACATACAC  TACAGGTGGA TTTGGTGTTG TAATAATGTC AAGGAAGATG CTGAACGATG GAGGTGTGGG AAGTGGTGGT GAAAGTGAAG ACAATCAGTA TGATTTTGAT TTGTTTGTGA TTGGTGCTGG  CAGTGGTGGT GTTAGGGCTT CCAGATTTTC AGCTCAGTAT GGAGCTAAGG TTGGGATTTG CGAGCTACCA TTTCATCCAA TCAGCTCAGA GACTATAGGA GGTGTTGGAG GAACGTGCGT  GATTCGTGGG TGTGTTCCTA AAAAGATTTT GGTCTATGGA GCGACTTTTG GGCCTGAAAT TCAGGATTCA AGGGAGTATG GATGGAAAGT CAACGAGACG GTTGATTTTG ATTGGAAAAA  GCTACTGCAC AAGAAGACGG ATGAAATAGT GAGGCTAAAT GGGATATACA AACGCTTACT TTCAAACGCG GGAGTCAAAC TTTTTGAAGG GGAGGGAAGA ATTGTGGGGC CGAATGAAGT  GGAAGTCATA CAATTAGATG GCACCAAATT GTCCTACTCA GCAAAGCATA TACTCATAGC AACTGGTAGC AGGGCTCAAC GTCTAGATAT CCCTGGACAG GAGTTAGCTA TAACATCTGA  CGAGGCTTTG AGCTTGGAGG AGTTACCAAA GCGCGTTGTT GTACTTGGGG GAGGGTATAT TGCGGTTGAG TTTGCTTCAA TTTGGCGTGG GATGGGTTCC ACGGTGAATC TATGTTTTAG  AAAGGAACTT CCTTTAAGGG GTTTTGATGA TGAAATGAGA GCTTTGGTTG CAAGAAATCT TGAAGGAAGA GGCATAATTT TGCACCCACA GACAAATTTG ACACAGCTGG TGAAAACAGC  GGATGGCATT AAAGTTACTA CAGATCATGG TGAAGAATTA ATGGCAGATG TTGTACTTTT CGCCACTGGG CGGATCCCAA ATACAAAGAG GTTAAATTTA CAAGCTGTAG GTGTTGAAGT  TGACAGTATA GGAGCAGTGA AGGTTGATGA GTATTCTCGC ACTAATGTGC CTAGCATATG GGCCATAGGT GATGCTACAA ACCGTATGAA TCTTACACCT GTCGCCTTGA TGGAAGGAAC  AATGTTTGCT AAAACCGTCT TTGGTAATGA ACCTAGCAAG CCCGATTATA GCAACATCCC TTGTGCCGTT TTTTGCATAC CACCTCTCTC TGTTGTTGGA CTAAGCGAAG AACAGGCCAT  AGCGCAAGCT AAAGGAGACA TATTGGTGTA CACGTCAACA TTTAATCCTA TGAAGAACTC CATCTCTGGA CGACAAGAGA AGACACTCAT GAAGCTTATC GTTAGTGCTG AGACCGATAA  AGTTATCGGT GCGTCGATGT GTGGGCCTGA TGCGGCAGAA ATTATGCAGG GCATTGCTGT TGCACTCAAA TGTGGAGCAA CAAAGGCACA ATTCGATAGC ACGGTGGGGA TACACCCGTC  GTCTGCTGAA GAGTTTGTTA CAATGCGCTC AGTCACAAGG CGTATTGCTG CAGCTGGTAA ACCGAAGACC AACCTCTAAA CTTGAATCGG TTGGTCGTTC CTCACAACTC ACATCCATAG  AGAAAACGGG TACACATTAT TTTGATTCAA TAACTTAAAC TTTTCATGTC ACTATCGATT ATTGTTAGCA TGTGAACGAT GTATCGTGTT AAGTTTCTCA TATGTGAGCT TTTGGGTTTT  TTGGAACGTG TCGATAGGAA TTGGAATGGA ATAGAAAAGG TAATGGATTG AGTAATGGGG TCCTTTATGG TTTCATTATT ATGTTTGTTT TGTAGTATAA AGTTTCGAAT TGAAGGAAAT  GAACGAACAA TGATAAGGTT GGGAATGGGG TCCTTTATGG TTTCATTATG TTTGGTTCGG GTGTTGCGGA TCAATAAAGC TGGTAGGCTG TCCCATAAAG ACTTTCTAGT AAGATGACCC 
TTTTAAATGC ATTTTTGACA TCGAGTTGAT GAAGCGATCA TTTTTGGATA ACAAGTGGTA ATACGTGAGA GTAATCCAAA CCCGGTATTT GGGTGAAACT TTTGAGCCCT TGGATG 

Retrieve as FASTA