Entry information : HaCPF02 (HanXRQChr07g0204451)
Entry ID 14246
Creation 2016-11-28 (Christophe Dunand)
Last sequence changes 2016-11-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaCPF02 (HanXRQChr07g0204451)
Name (synonym) HaCPF02 (HanXRQChr07g0204451)
Class CPF Grx    [Orthogroup: CPF001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaCPF02
start..stop
S start..stop
HaCPF04 476 9.28e-171 1..333 1..328
AtCPF05 404 1.62e-142 1..332 1..314
ThasCPF05 393 5.91e-138 99..332 91..320
MpCPF03 370 1.98e-128 89..331 87..326
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14246' 'join(95541105..95541456,95542938..95543072,95543188..95543278,95543380..95543474,95543577..95543744,95546693..95546853)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 95541105..95541456 350 N° 2 95542938..95543072 133 N° 3 95543188..95543278 89 N° 4 95543380..95543474 93
N° 5 95543577..95543744 166 N° 6 95546693..95546853 159  
join(95541105..95541456,95542938..95543072,95543188..95543278,95543380..95543474 ,95543577..95543744,95546693..95546853)


exon

Literature and cross-references HaCPF02 (HanXRQChr07g0204451)
DNA ref. HanXRQ genome:   HanXRQChr07 (95541105..95546853)
Protein sequence: HaCPF02 (HanXRQChr07g0204451)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333
PWM (Da):   %s   36923.93  
PI (pH):   %s   8.86
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRRVSTLAASSLSRAILSSSEHHHYKILFPAASSFAANAGSSRRWFSSPVGSISSGGSPSATKVFLSLGCLAASAAAGASLLAEKEAYAKEPVKLDLLPKEVVLYQYESCPFCNKVKAFL
DYYDVPYKVVEVNPLSKKEIKWSDYKKVPILVVDGEQLQDSS
AIIDQLRNKLSPPAKSSSLVDGDDEEKKWRRWVDDHLVHVLSPNIYRNASEALESFDYFTSGNFSFSEKYTVKYAGAA
AMYFVSKKLKKKYNITDERAALYEAAETWVDALDGREFL
GGSKPNLADLAVYGVLRPIRYLRSGKDMVEHTRIGEWYTRMESAIGESSRIKA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAAGAGTCTCCACACTCGCCGCCTCCTCTCTCTCACGCGCCATCCTATCTTCTTCCGAACACCACCACTACAAAATCCTCTTTCCGGCAGCCTCCTCTTTCGCCGCCAATGCCGGA
TCCTCTCGCCGGTGGTTCTCTTCACCTGTAGGATCCATTTCCTCCGGCGGCTCTCCCTCCGCCACTAAAGTTTTTCTCTCGTTAGGTTGTCTCGCCGCCTCCGCTGCTGCCGGTGCGTCG
CTCTTGGCGGAGAAAGAGGCGTATGCGAAAGAGCCGGTTAAGTTAGATCTGCTTCCGAAGGAGGTTGTGCTGTATCAGTATGAATCGTGTCCGTTTTGTAACAAGGTTAAAG
AGGTATTG
GTGATTAGTTTTCGTGTTCAGCAAGTTTTGTGTTGTGTGTAGATTTAGGGCAAACTGTTAGGAGTAGTGTGATTTAGAGGAGAATGTTGCTGTTGATATTAATATATGTGAGTATAGCTA
TTGTTTGTGTTTTATTAAATTGTTATGGACTTATGGTTGTTGAACTTCATATATGGATTTAATATGGTTGTAGTTAAAAGCATGATAGAGAGCATTGTTGTTGGTGATCAGTTGCATTGT
TTTGGATATGCGATCGAACTTGAGTACTTGACAATAGTTAGGTAATCAAGTTTAATGTCTTGGTATGAGTATGATATTCTTTTGAAGAAAGAAGTGTGAGGGGGTGTTTGAGATTGGTTA
TTAAGATTGCTTATCTGCCACTTATTCTTAACATCTTTTAAAGCAGTTTAGAATAGCAATACATCCTCAAAACATAGTATGGGTATGTTTGGCATGGAGCTTTTAGGAGCTTCTAGCTTT
AAGCTTTTAAGAAAAAGCTCCTACTCAATAAAAAGTCTTGTTTGGTTGAAGGAGCTTTAAGCTTTTAGGTTAGGAGCTTGAAGCTTTTGGTTGAACGCTACTACTAGTAGCGTTTAGAAG
GAGCTACAAGCTTTTAGGAAAAAAATGACTATTTTAACCTCTAAAAATAAGGAACTTTTTAATGCACCAACTTTCTAAATTTTTAGTTAGGTCCATTTTGGTCATTTTATACATTTTATT
AAAAGCTCCAGCTACTCTACCAAACACCAAATATATCTAAAAAGCTACAACTACTAGCTACCAGCTACAGCTATCAGCTTCCAGCCACTAGCTACCAGCTTCCAGCTTGCAACTACCAGC
CACCCGCTACTTTTGCCAAACATACCCTATATCTGTATTAAAGCACACAGAAGCAGTTATGCTTAGGATTCCCTAACACCCCCAATGGTAGTTTCGAAGACATGTTTTCGAAAACAATGA
AGTATGAACATAAGTGCATGAAGAAAAATGAAACTGAATGATGATAAAGTGAACACAGTTTGGTTCATTGTTTATAGTTGTGATGAATTCCCTCTAAGCTTGAAATTATGTTACGACTTA
CCATGTCTCTGATCACCAAATCATAATTTAATAGACTATATTCCATGCTAGCAAGTTTCTTGAAATACATTCGTTTTAGCATCTTTAAATACATGCATAGCAGTGCATTATTTGAAGTAT
ATATGGAGCATTATGTTAGATGAAAGGCAGATTCTTTTCTGAAGGTATTGAAGCACGGGTTAGGGTAGAAAAAGTTTTAAGAATGATTTTATGTGTTTCATAACTCATAATTTCTGCAAT
GTAAGAACCATACATTAAATCCTTGTGTTTGTTTTTGTTATAAGATTCATTGTAGCGAAGGTCAAGTTTGTTTTAGGTATGCTTTGCAAGGGAAGCAGGGTATGTAGAAGCAAGGAAAAA
TGGATATATGATACCTACTTTGCTTGTTTTTTCAGCGTTTCTAGATTACTATGATGTGCCGTACAAAGTTGTGGAGGTGAACCCACTTAGTAAGAAGGAAATCAAATGGTCTGATTACAA
GAAGGTGCCTATACTAGTTGTGGATGGTGAACAGCTGCAAGATTCATCAG
AGGTTATATTTGAATTAATCATAATTGACTTATGATTCTCTTCTCATCCTCTAAGTTCAGTATTTAAGCT
TGAATTAAAGGTGTGATAAAGTTCTATAATATAAATATTTATTGCAGCTATTATTGATCAGCTCAGAAACAAGCTCAGTCCTCCCGCGAAGTCAAGTTCACTGGTTGACGGTGATGATGA
AGAAAAGAAGTGGCGTCG
CGGTATGCTTCTTATTCGTATTCTCTTTCTTATGTCACATTTTTTTATACATATCTAAGCTGTAGGAATTTTGCAAATTTTCTTTTTATGTTTAATGCTTTA
GGTGGGTTGATGATCATTTGGTTCACGTTTTATCACCGAATATTTACCGAAACGCTTCTGAGGCTCTGGAATCCTTTGACTATTTCACTAGCAATGTGGTGAGCCAGAAATATGGTATAC
TGAAGTTAATTTAGTATAGATATATATATCTTTTTTTAAATCTGTAAAGAATCTATAACAATCTTGAACTTTATATTCAGGTAATTTCAGCTTTTCGGAAAAATATACAGTAAAATACGC
GGGGGCTGCTGCTATGTATTTTGTATCTAAGAAACTGAAGAAAAAATATAATATCACTGATGAAAGGGCAGCTTTGTATGAAGCTGCTGAAACCTGGGTTGATGCCCTTGACGGCAGGGA
GTTTTTAG
AGGTCAGTTTTTTTGGTGACGTTTTGATCCTTCTTTTGTCAGTGTTTATTCTGTGTTTCACTTGACTTTTACTTTTCAACTTGAAGTGTCAATTGTCAAAACAGTCGGGCAA
ATGCATCATGCTCAATTTGATTTTAGATAGTTCATATTTTATACAATTAAAGACTATATTATTAGAAAATTTATCTAATTTATACACTGGAGGACTATTGACCCATTTTGGGGAATTGGC
CTGTAATAATCTCACCAATAGCTTATTGGCCATTAATAATCCCACCTCAGAATATTCCCCCCACCAGTCCCACCTTTCACCTATTTTTCCTACAATGGTCCCCCGTTAAAAAAACTTAAC
GGAGTTAAGCTTTTTTTCCAAATAACAAACAGATTTTTTTGGGCTTTTGATCAGAACAATGATACGAGCCCATTGATGTAAAACTTACTTCGAAATGGTGCTCCAAGTAACTTGATTTTG
GTTAATTGGAAATTTAAACACCCGAATTGAAGCGTCGTTTTCATCGATTGGAGCACCATTTCGAGGCAAGTTTTACATCAATAGACTCGTATCATCGTTCTAATCAAAAGCCCTAAAAAA
TCTGTTTGTAATTTGGAAAAAAGCTTAACTCCGTTAAGTTTTGTTAACGGAGGACCATTGTAGGAAAAATAGGTGAAAGGTGGGACTGGTGGGGGGAATATTCTGAGGTGGGATTATTAA
TGGCCAATAAGGTCTAGGTGGGATTATTACAGACCAATTTCCCTTACCTTTTCAGCTAAATGCTTTGCTTTTTCTTATTTGACCCGTTAGAGATAAAACATAAGCCAAATAGACCCATTT
GTTAGTAACTGGGTTGAAATGGCCACCTCAAGGGTTGGTCTAGTTGATATGCTTTTAGAGGTGCCAAATTGGATGAGTTGGGTAACGGGTTAAATTGGTTCAGGTCAGGTAGACTGATGC
ATGAACACTTTGCTTTATTGTTTTCTTGATAATTTTGCAAGTAATTAGTGCGAGGTATGGTTAGCATAACTATATTATTACAATGATACACTAGTTTTTTTTGTATAAATCAGTTTAACG
ATGTTATGCATTTTGGGTGACTTTGACCCGTTTTTCTCAGTTCTTTTTACCCAACTTTAAGTGTGACCTATTGGATTTTAAGGGTGATGGTGCATTTTGTATGGGCCTCATGCATAGTTA
TCTATGTGAAGATAGCATTCACTATTGCGCGCTTCATAGTGTAATGCACATATCTTGCAATTTGTTAATTAGCGACTCCATAGCATGATTATAGCGGGATTCCGACGATGAATTCCGGCT
CCGGTGCTGCAATTTCTGATGGAAACCAGGAAGAAGAAGAAGAACGGCTGCGTGTTTCTTGCGTTTTAGCCTTTTAGGGTTAAATAACTTCATGTATTTTAACATTTAACCCCTTTTATC
TTTCACTAGTTTACATTTAGTCCCTAAAACTTGTAAAAACTTACATAAAAAGTGTAAAATTAGTTTCTATATTTTAATAGTTAACCCCTCTATTCTTCACTAGTTTACATTTGGTTCCTA
GAACTTGTAAAAACTTACATAGTGTAAAATTAGTTTCTGTATTTTAACATTAACCCCTTTAATTTTCACTAGTTTAAATTTGGTCTTTATACTTCTAAATTTATACATAATAAGTATTTA
ATATATATTTATATGGGAAGGATAAAATGAAAACCCACTTGAGTTGAAAAGACCCAAGAAACCCTTGTAAAAACCCTATGTAACATTTTAATTTTTTTTTCTAAAAAAATAAGGAATGTA
ACATACATGTATTTGATCATTTTTGTAAAAAAAATGCGCCGAGTAGTTTTTTTCTTTTTTAAAATGTTAGAAATTCCATGTTACATAATATATGTCCAAAAAATGTAACATACAGATTTT
GAACATTTAAAAAAAAGTAGTCGGCGCTTTTTACATTTTTTTATAAAAATGTTCATATATTTACATTCCCGGTTGTTTAGAAAAAAAATAAAAATGTTACGCAGGGTTTTCGTGAGTTTT
TTCAACTCAAGTGAGTTTTCTTCCTATATGTGTGTGTGTGTGTGTAAAAATTATAAATAGCTACTTTTTCTTTCTTAAATTTTTAACTACCTTATCGCTAAACACAAAATAACGGGCACT
ATTTCATCGCTATTGCTACGTGGCATATAGGTACCTTGGCGCAATTTGTTGCTATTCGCTATCGATAACTAGGGCCTCGTGTAGTAGTTAGGCCAATGGTGCTAAATGTCGGTATGTCAC
TGTTAGAGATACACGTATAAGGAAACAAGGTTTCCTTTAATTAGTTTCTTCATTTAGGCTATATTGTATATCTATTAGACCATGCGTAATGGTTAATGCACCCTGAGGGGCAATTTTTGC
CACATCAACATCATAAAGCCCCCTTCAAAAAATGTAACTGTTAATGCTTCTTAATGCCCATTTCATTCAATACTTCCCATTTTTTTCTCCTCTTTGGGCATTATTCTAGAAATGCACCTC
CCTCTTCATGCCCCTATAACGCATAGGGGGATGGTGCTGGGGGCGTTATCAAACCCTTTCATGCCTCTATAATGCCCATTATGCATGGCCTTAGGCCATCTGTAATGGTTAATGCCCTCT
AATGGGTATTTTCCGCCACATCAACATCTTAAGGCCCCTTAAAAAATTGTGTAATGGTTAACGCTCCTTAATGCCTTCATTAGTTTCCAATTTTGTTTTCTTCATTGGTCATTATATTAG
AAATGTCCCTCCATCTTCATTCCCCTATAAATCCCACGGGGATGGTGTGGGGGAATTATCAAGCCACTTCACGCCCCTATAATGCCCACTACTCATGGTCTTAAAGGAGTTGCCCGACAA
ATATATCAAGCAATATATTCCTGATCTGGATACTAAAAAATCTTATTATTATTTTTGTATGTCTTATGACTGCATCAGGTGGTTCTAAACCTAATCTGGCTGATCTTGCTGTCTACGGAG
TGTTGAGACCTATCCGTTATCTGAGGTCGGGTAAAGATATGGTTGAGCACACCAGAATTGGCGAGTGGTATACGCGAATGGAGAGTGCTATTGGTGAATCTTCAAGGATAAAGGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAAGAGTCTCCACACTCGCCGCCTCCTCTCTCTCACGCGCCATCCTATCTTCTTCCGAACACCACCACTACAAAATCCTCTTTCCGGCAGCCTCCTCTTTCGCCGCCAATGCCGGA
TCCTCTCGCCGGTGGTTCTCTTCACCTGTAGGATCCATTTCCTCCGGCGGCTCTCCCTCCGCCACTAAAGTTTTTCTCTCGTTAGGTTGTCTCGCCGCCTCCGCTGCTGCCGGTGCGTCG
CTCTTGGCGGAGAAAGAGGCGTATGCGAAAGAGCCGGTTAAGTTAGATCTGCTTCCGAAGGAGGTTGTGCTGTATCAGTATGAATCGTGTCCGTTTTGTAACAAGGTTAAAG
CGTTTCTA
GATTACTATGATGTGCCGTACAAAGTTGTGGAGGTGAACCCACTTAGTAAGAAGGAAATCAAATGGTCTGATTACAAGAAGGTGCCTATACTAGTTGTGGATGGTGAACAGCTGCAAGAT
TCATCAG
CTATTATTGATCAGCTCAGAAACAAGCTCAGTCCTCCCGCGAAGTCAAGTTCACTGGTTGACGGTGATGATGAAGAAAAGAAGTGGCGTCGGTGGGTTGATGATCATTTGGTT
CACGTTTTATCACCGAATATTTACCGAAACGCTTCTGAGGCTCTGGAATCCTTTGACTATTTCACTAGCAATG
GTAATTTCAGCTTTTCGGAAAAATATACAGTAAAATACGCGGGGGCT
GCTGCTATGTATTTTGTATCTAAGAAACTGAAGAAAAAATATAATATCACTGATGAAAGGGCAGCTTTGTATGAAGCTGCTGAAACCTGGGTTGATGCCCTTGACGGCAGGGAGTTTTTA
G
GTGGTTCTAAACCTAATCTGGCTGATCTTGCTGTCTACGGAGTGTTGAGACCTATCCGTTATCTGAGGTCGGGTAAAGATATGGTTGAGCACACCAGAATTGGCGAGTGGTATACGCGA
ATGGAGAGTGCTATTGGTGAATCTTCAAGGATAAAGGCCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTAAAAAGGC GGTTCTATTT TTCAACAACT CATACACACG GTCCCGAGTC CACCAGGTAG CACCAACTTA CACCATCCAC CCCATTCCAC ACACCTCTAA ATATTCTCTC CACCTCCGGC  CACCGTACAC AACCACCGTA AAACCCTAAA AACCATGAGA AGAGTCTCCA CACTCGCCGC CTCCTCTCTC TCACGCGCCA TCCTATCTTC TTCCGAACAC CACCACTACA AAATCCTCTT  TCCGGCAGCC TCCTCTTTCG CCGCCAATGC CGGATCCTCT CGCCGGTGGT TCTCTTCACC TGTAGGATCC ATTTCCTCCG GCGGCTCTCC CTCCGCCACT AAAGTTTTTC TCTCGTTAGG  TTGTCTCGCC GCCTCCGCTG CTGCCGGTGC GTCGCTCTTG GCGGAGAAAG AGGCGTATGC GAAAGAGCCG GTTAAGTTAG ATCTGCTTCC GAAGGAGGTT GTGCTGTATC AGTATGAATC  GTGTCCGTTT TGTAACAAGG TTAAAGCGTT TCTAGATTAC TATGATGTGC CGTACAAAGT TGTGGAGGTG AACCCACTTA GTAAGAAGGA AATCAAATGG TCTGATTACA AGAAGGTGCC  TATACTAGTT GTGGATGGTG AACAGCTGCA AGATTCATCA GCTATTATTG ATCAGCTCAG AAACAAGCTC AGTCCTCCCG CGAAGTCAAG TTCACTGGTT GACGGTGATG ATGAAGAAAA  GAAGTGGCGT CGGTGGGTTG ATGATCATTT GGTTCACGTT TTATCACCGA ATATTTACCG AAACGCTTCT GAGGCTCTGG AATCCTTTGA CTATTTCACT AGCAATGGTA ATTTCAGCTT  TTCGGAAAAA TATACAGTAA AATACGCGGG GGCTGCTGCT ATGTATTTTG TATCTAAGAA ACTGAAGAAA AAATATAATA TCACTGATGA AAGGGCAGCT TTGTATGAAG CTGCTGAAAC  CTGGGTTGAT GCCCTTGACG GCAGGGAGTT TTTAGGTGGT TCTAAACCTA ATCTGGCTGA TCTTGCTGTC TACGGAGTGT TGAGACCTAT CCGTTATCTG AGGTCGGGTA AAGATATGGT  TGAGCACACC AGAATTGGCG AGTGGTATAC GCGAATGGAG AGTGCTATTG GTGAATCTTC AAGGATAAAG GCCTAATCTT ACGGTGAAAT GATATGCAAA AGTAAAGTAT ATATACATTT  TGCCTTCAGT CTTGATTGAA TTATGTTGAT GAGATTTTGT TAAATTTTTG TTGTTGCTAT GAATTTGTAG CACGATATCG GTTTTCTTTT TGCTGTAACA GATTAGAACC AGTGCCACAC  ATAGGCTGGT ATAGTACAAT AATAGAGAAA AGACTGGTAG GATGTGATCA TACTATTATT GATACAAAAA AAAATAAAAC TCATCAAAAC TTTGCATTTT AGTGTTTGGT ACTATTGGTT 
TTGATAGCAG GTTAGTGTGT TTGTG 

Retrieve as FASTA