Entry information : HaDHAR11 (HanXRQChr08g0220001)
Entry ID 14247
Creation 2016-11-28 (Christophe Dunand)
Last sequence changes 2016-11-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaDHAR11 (HanXRQChr08g0220001)
Name (synonym) HaDHAR11 (HanXRQChr08g0220001)
Class Dehydroascorbate Reductase    [Orthogroup: DHAR001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaDHAR11
start..stop
S start..stop
HaDHAR12 374 3.69e-134 1..214 1..208
ThasDHAR01 341 2.57e-121 1..212 1..211
AtDHAR04 328 6.43e-116 1..212 1..212
AtDHAR02 315 4.49e-111 1..212 1..212
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14247' 'join(42328911..42328968,42329066..42329156,42329247..42329390,42329477..42329594,42330222..42330362,42330677..42330769)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 42328911..42328968 56 N° 2 42329066..42329156 89 N° 3 42329247..42329390 142 N° 4 42329477..42329594 116
N° 5 42330222..42330362 139 N° 6 42330677..42330769 91  
join(42328911..42328968,42329066..42329156,42329247..42329390,42329477..42329594 ,42330222..42330362,42330677..42330769)


exon

Literature and cross-references HaDHAR11 (HanXRQChr08g0220001)
DNA ref. HanXRQ genome:   HanXRQChr08 (42328911..42330769)
Protein sequence: HaDHAR11 (HanXRQChr08g0220001)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   214
PWM (Da):   %s   23859.52  
PI (pH):   %s   5.97
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIEICVKAATGAPDVLGDCPFCQRVLLTLEEKKVSYKTHLINLDSKPEWFLEVNPDGKVPLIKFDEKWVSDSDVIVGLIEEKYPEPSLITPPELASVGSKIFPKFVGFLKSKDENDGTE
QALLDELNALEEHLKN
GPYVNGEKVTAVDLSLAPKLYHLKVALGHFKKWSVPESLTHVHNYIKSLFSRESFEKTKPAKEEYVIAGWAPKVNNA*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATTGAGATCTGTGTCAAAGCTGCTACTGGTGCCCCTGATGTTCTCGGAGACTCTGTAATCAATCTCTCTTTATTTACCCATTTCATAAAGATCACATTTTTATCATCTTGAATG
TTTATGTTTTTTTTTTTTTTTTTTTTCTAATTTTTAGGTCCATTTTGCCAAAGGGTACTTTTGACTCTGGAAGAGAAGAAAGTTTCTTACAAAACCCATCTCATAAATCTTGACAGCAAG
CCAGAATG
TGGTGGGTGATCATGAGTGTTTCAGAATCTTGAAAAAGTAAACTTTTTTTAGGGTTTTTAATAACTTTTTATGTGAATTTTTACGTGTTTAGGTTTCTTGAAGTGAACCCAG
ATGGGAAAGTTCCTTTGATAAAGTTTGATGAGAAATGGGTGTCTGATTCTGATGTTATTGTGGGTTTGATTGAAGAGAAGTATCCTGAACCTTCTCTTATTACTCCCCCTGAACTTGCCT
CTGT
GTGTATGCATCTCTTAATTTTGCATGTTCTTGAATGAATTTTATATAATTAATTGATATTTTATATAATTAAATTTTGACTTTTGTAGGGGGTCAAAGATTTTCCCAAAGTTTGTG
GGATTCTTGAAGAGTAAGGATGAGAATGATGGGACTGAACAGGCTTTGCTTGATGAACTGAATGCATTGGAAGAACACCTCAAGAACAAG
AGGTATGCTTTATCAAATGCCATTTTTTTT
ATATTATTGGGTGGTGTTTGGTTTGTCGGAATTCAATAGAATTGGAATCCTTTCAGGTGACGCGCTGCGCTTCTGCACCTAGGCGTGCGCCTAGTGCGCTTTTGACAACATAGGAGTTCC
TTAGATTTTTTTAACAAATTTTAAATCCATATGCAATTCATTCAAATTCAAATTCTTTTGATTTGATGAATTCCAATTACTTTAAAAAAGATTTAACGAACTAAATGCCCCTTAGGTGCT
GTTTGTTTACCTCTTAATGAGGCTCTTAATGGTTCAGACCTGTTACTGGTTCAGCACTTAATGGTTCAGACTGTTTGTTTCACGAGCAGATGTCTGAATGGTTCAGATATTTGCCTTTGA
ATGGTTAAGCATTATACAAAGTCTGAATGGTTAAGACCTCTAATCTGAATTGGTCAGACATTTGCCTCGGAACGGCTAAGCATAATACCGGCTCTTAATGGTTAGACCTCTTACTGGTTC
AGCACTTGATGGTTCAGACCTCTGAATGGTTAAGCATTATACAAGATGACTGTTTTTAGTTGGGGCCAAATGTGTGTTTTTTGTTCGCTTGAATGATGATAACGTGTTTAACGTATCAGG
GCCCTTACGTTAACGGAGAAAAGGTCACAGCCGTTGATTTGAGTTTGGCGCCAAAGCTGTACCACCTTAAGGTGGCTCTTGGTCATTTCAAGAAGTGGAGTGTTCCAGAAAGTCTGACTC
ATGTGCATAACTACATAAAG
AGGTATGACTAATTCTGGATCTTCTTTCAATTAAGGGATATTTAGCTTTGTATATTGAAAGTAATTTGTCTGGTTATTCGGTATAAATGTATAATGATAA
TAATTTTGGTTGATTTATTATTCAGGGGTGGTTAGATAACCAGTTTAGTGGCAAATGTGACAAAACTGATAATGATTATTCAATTATAATCACAAGTTGTCAAACATTATTTGATTAACC
ACAACTTTAAAAAATAATGCAACATCCAAACACTCTCTCTTATGCCCCCTTTTGTTGCGGTTATAACTTATGATGACGGTGATTATGTTGATGCAGTCGCTCTTCTCTAGGGAGTCGTTT
GAGAAAACAAAACCTGCTAAAGAAGAATATGTGATTGCTGGATGGGCGCCAAAGGTTAATAATGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATTGAGATCTGTGTCAAAGCTGCTACTGGTGCCCCTGATGTTCTCGGAGACTGTCCATTTTGCCAAAGGGTACTTTTGACTCTGGAAGAGAAGAAAGTTTCTTACAAAACCCAT
CTCATAAATCTTGACAGCAAGCCAGAATG
GTTTCTTGAAGTGAACCCAGATGGGAAAGTTCCTTTGATAAAGTTTGATGAGAAATGGGTGTCTGATTCTGATGTTATTGTGGGTTTGATT
GAAGAGAAGTATCCTGAACCTTCTCTTATTACTCCCCCTGAACTTGCCTCTGT
GGGGTCAAAGATTTTCCCAAAGTTTGTGGGATTCTTGAAGAGTAAGGATGAGAATGATGGGACTGAA
CAGGCTTTGCTTGATGAACTGAATGCATTGGAAGAACACCTCAAGAACAAG
GGCCCTTACGTTAACGGAGAAAAGGTCACAGCCGTTGATTTGAGTTTGGCGCCAAAGCTGTACCACCTT
AAGGTGGCTCTTGGTCATTTCAAGAAGTGGAGTGTTCCAGAAAGTCTGACTCATGTGCATAACTACATAAAG
TCGCTCTTCTCTAGGGAGTCGTTTGAGAAAACAAAACCTGCTAAAGAA
GAATATGTGATTGCTGGATGGGCGCCAAAGGTTAATAATGCATGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  AAAAACCTGT ATTAATACCT CTTCACTCAA CTCACCTCTC TTCATCAAAC CCAAAAACCT TCAGCTTTAA TGGCGATTGA GATCTGTGTC AAAGCTGCTA CTGGTGCCCC TGATGTTCTC  GGAGACTGTC CATTTTGCCA AAGGGTACTT TTGACTCTGG AAGAGAAGAA AGTTTCTTAC AAAACCCATC TCATAAATCT TGACAGCAAG CCAGAATGGT TTCTTGAAGT GAACCCAGAT  GGGAAAGTTC CTTTGATAAA GTTTGATGAG AAATGGGTGT CTGATTCTGA TGTTATTGTG GGTTTGATTG AAGAGAAGTA TCCTGAACCT TCTCTTATTA CTCCCCCTGA ACTTGCCTCT  GTGGGGTCAA AGATTTTCCC AAAGTTTGTG GGATTCTTGA AGAGTAAGGA TGAGAATGAT GGGACTGAAC AGGCTTTGCT TGATGAACTG AATGCATTGG AAGAACACCT CAAGAACAAG  GGCCCTTACG TTAACGGAGA AAAGGTCACA GCCGTTGATT TGAGTTTGGC GCCAAAGCTG TACCACCTTA AGGTGGCTCT TGGTCATTTC AAGAAGTGGA GTGTTCCAGA AAGTCTGACT  CATGTGCATA ACTACATAAA GTCGCTCTTC TCTAGGGAGT CGTTTGAGAA AACAAAACCT GCTAAAGAAG AATATGTGAT TGCTGGATGG GCGCCAAAGG TTAATAATGC ATGAAGTTGT  CCCAAACTAT AGCCTTAACA ACTCGCGTTA TCATATGAAT GTAATATGTT ACGTCATGCA CCATATGTTT TTTTCATGTG TTACTAGTGC ATAAACATTT TGATGGTGCT ATATACTAAT  GTGTGAAGGA GTCTTGTTAA AGTTTTAATT GCGAAAGTTG GTGGTTGTTA CTTATGACTT ATATGCAAGT TGTTCGGTTG CTTCGAATAT ATTATTTTTA GGCTTTTGAA ATTTGCTAGC 
CAAAGCATTG TTTAGATATG GATTTGTACA TGTGATCTTA CAAAAGTTCA AATTGAACCG AACTTAAATT AGCTCAAGCT TGTTTACTAA GCGCCTAAGC CTAAACAAGT CATATTATT 

Retrieve as FASTA