Entry information : HaDHAR12 (HanXRQChr12g0371001)
Entry ID 14248
Creation 2016-11-28 (Christophe Dunand)
Last sequence changes 2016-11-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaDHAR12 (HanXRQChr12g0371001)
Name (synonym) HaDHAR12 (HanXRQChr12g0371001)
Class Dehydroascorbate Reductase    [Orthogroup: DHAR001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaDHAR12
start..stop
S start..stop
HaDHAR11 374 3.59e-134 1..208 1..214
ThasDHAR01 329 1.48e-116 1..207 1..212
AtDHAR04 310 3.46e-109 1..207 1..213
AtDHAR02 295 3.6e-103 1..206 1..212
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14248' 'join(66497411..66497468,66497555..66497645,66497757..66497900,66499106..66499223,66499337..66499477,66500292..66500366)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 66497411..66497468 56 N° 2 66497555..66497645 89 N° 3 66497757..66497900 142 N° 4 66499106..66499223 116
N° 5 66499337..66499477 139 N° 6 66500292..66500366 73  
join(66497411..66497468,66497555..66497645,66497757..66497900,66499106..66499223 ,66499337..66499477,66500292..66500366)


exon

Literature and cross-references HaDHAR12 (HanXRQChr12g0371001)
DNA ref. HanXRQ genome:   HanXRQChr12 (66497411..66500366)
Protein sequence: HaDHAR12 (HanXRQChr12g0371001)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   208 (297)
PWM (Da):   %s   22983.13 (31910.7)  
PI (pH):   %s   6.8 (7.25) Peptide Signal:   %s   cut: 26 range:26-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIEICVKAATGAPDVLGDCPFSQRILLTLEEKKVAFKTHLINLD
NKPK
WFLEVNPDGKVPLAKFDENWISDSDVIVGLIEEKYPHPSLATPPELASVGSKIFPKFVVFLKSKDANDGTEQALLDELNALDEHLKSGPYVTGKTITAVDL
SLAPKLYHLEVALGHFKKWTVPESLTHVRNYMK
SFEKTKPAKEEYVVAGWAPKVNSA*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATTGAGATCTGTGTCAAAGCTGCTACGGGTGCCCCTGATGTTCTTGGCGACTCTGTAATTAATCTCCCCTTCAAAGATTTCACTTTAATTTCATTGGGGTTTCTTGATCATCAA
TTTTTGTGGGTTGTGTTTGATTTTAGGTCCATTTTCCCAAAGGATTCTTTTGACTTTGGAAGAGAAGAAAGTCGCTTTCAAAACCCATCTCATTAACTTAGACAACAAACCTAAATGTGG
TGATTATTATTAGTATTATTGTCAGAGAATCTTGAATTTACACATGAAACGTTTGGTTGTTCGTGGCCTCGTGGGATTTTAATATAATTTTTTTTTTTGTGTTTGTGTAGGTTTCTTGAA
GTGAACCCAGATGGGAAAGTTCCTTTGGCCAAATTTGATGAGAATTGGATATCTGATTCTGATGTTATTGTGGGTCTTATTGAAGAGAAGTACCCTCACCCTTCACTTGCCACTCCCCCT
GAACTTGCCTCTGT
GTGTATGCTCTGCCTGGCTCTGTATATATGTCATATGATACAGGTTTATTACGAAATCGGTGGGTTTGAGTTTAGTCTAATTGGGTTTGGGTCGGTTTTAGGCAAA
TCCTTGAACATGTTTAGCTAAACTGGTCCTGCTTGGGTTGTTTTGTCAGTTTGCGGGTTGATCGGTTTAACTCTTCTCTCATAAATTTTTAAAAATATAAAAAACAGACATATGGTGTAC
AGCTCAGATGAAATTATTTTATTTATATTTGTTTACATGGTTGTAATATGTTATTGTCAGGTAAGGATATTTCAAAAAAAAAAAATAAATAAAAATAAAAATAAAATAAAAATATTGGGT
TCAATAGGGATGGCAAAAAAACCAGAACCCGATGGGTATACCCGAAATCCGAAACATATGGGACGGGTACCCAAACCCCGACGGGTAATGGACGGGTATAATACGTAGTTGTGCTTGATT
TTTCCCTCGACATTCTGTTATATGTTTTTGTTAAAAACGAAGTTGTACTTAAAATAAAATATTTCTTTGGTAGCATAAAACAGTACGATGATCAATTAAACCGTTCTAATGGTTTGGCTT
TCTAAACAACATGCTTTATTTTCAAATCACGTTTGTTTTACATTATCATTTGTTCGGTTTCGTCGCAACGCGCGACTTCAAAAAAACTAGTAGTAATAAAAATGTATTTGAAAATTTCAA
TCGGTATCTTTTAACAGATTAATGGGTATACCCGATACCCGCGGGTATGCCCAATACCCGACAGGTATTGGGCCGGGTATCGGACACGATTTTACAACCGGGTATGGGTATGAGATTACC
AATACCCGCCCCGAACCCGACCCATTGCCATCCCTACGGTTCAACGGGCCGTGTTTGTGTCGATCCATGAAAACTTGTGTTGTATTGTATCTGGGTTCATGTGTTTGATTTTGAATTCTT
GTCACGTTCGGGTTGTTAAATTTTCACGTTAGTGTAGGGTTTGACCCGCTAATCTGTAAGCACGCCCCGTTAAACACCCCTAAATAGTATATAATTACCACCTATAAGATGGCAAATTCA
AGTTGTTTATGAAAAATTTGCATTTCTAAACTCAAATGACCATTTATGAAATTTTGATTTATTTCATAAACATAAGTTTAGATTTTCCCAAATTGACCAATTAATTGCACAATTATAATA
CTTCTAATTGTGAAATTGTAGGGGGTCAAAGATTTTCCCTAAATTTGTGGTATTTCTAAAGAGCAAGGATGCTAATGATGGGACTGAACAAGCTTTGCTTGATGAATTGAATGCATTAGA
TGAACACCTCAAGAGTAAA
AAGTACGTTTTTTTTTTTTTTTTTCCAAAATGATTGTTTTTTTTGCTCTATTTGGTTGATACAAAAATATGTGTTTTTATTTGAATAATAACTAACCTTTA
TGTTAACATGTTAGGGGCCTTATGTTACTGGGAAAACGATCACAGCTGTTGATTTGAGTCTGGCACCAAAGCTATACCATCTTGAGGTGGCTCTTGGCCATTTTAAGAAGTGGACTGTTC
CCGAAAGTCTGACTCATGTGCGTAACTACATGAAG
AGGTATGACTCTCGCGTATTGAAAGTGATGGTCTGATTATTGAGTTTATAGTGTTGGGTGTGCAAGTGTATAACAAACCCTTTCT
GAGTTTTTAAATAACCAGTGTTTGTCGATTAGTTGCTCATTTTGTACAATTAGCAGTAGTTTGTTTAAATTTATATATAAACATATTGACTAAATCATTACAATGAAATTTAGAAGTACA
AAAATTTGAATTATATTGTGTCTTATACGGGCTTGATTGACTCGAGTTTTGTTAGTTTGATTAAGCTTGGGTCGGTTCAGGTCAGGTCCTTTTGGCTTAGTTTTGCCTCACTTTTCGTGA
ATCAGTCCGTGTTGTCTTACATGTAGGGTTGTAAATGAGTGTGTCAACTCACAAGTTACTCAATACCAACTATAAATTTGAAACTTGCTCGATTGAAGAAAAGTTGAGCTTGAGCTACTG
GAGTAGACTTTCAAGTTGAGCTTTAGTATTAAAGTCTCCGCTTGTAAAAGTCGCTAGCATTATATTGCCATTTTACATTTTTACCCATTGTGTATATGTGAACTTACATAATTGCAGGCC
AGTACTATCTAGTGAGTCGATCCAAGCGGAGCTCAAAAGTATCTAGTCGAGTCAGTCTTAGCTCATCAAATGATATGACACTAATTACTAACCTTGATTATTATTATTGTTATTATTTTA
ACTTTGATAATCTTGTATACACAAGTCAAGCCTGATCTTGGCATTGTGTTGAATCGGTCAAGACCAAATTACCCCCCATCTTTTTTTTTTTAATACTTATTATGTTAATGCAGTTACTCT
TTTCAAGGGAGTCGTTTGAGAAAACCAAACCTGCTAAAGAAGAATACGTCGTTGCTGGATGGGCGCCAAAGGTTAATAGCGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATTGAGATCTGTGTCAAAGCTGCTACGGGTGCCCCTGATGTTCTTGGCGACTGTCCATTTTCCCAAAGGATTCTTTTGACTTTGGAAGAGAAGAAAGTCGCTTTCAAAACCCAT
CTCATTAACTTAGACAACAAACCTAAATG
GTTTCTTGAAGTGAACCCAGATGGGAAAGTTCCTTTGGCCAAATTTGATGAGAATTGGATATCTGATTCTGATGTTATTGTGGGTCTTATT
GAAGAGAAGTACCCTCACCCTTCACTTGCCACTCCCCCTGAACTTGCCTCTGT
GGGGTCAAAGATTTTCCCTAAATTTGTGGTATTTCTAAAGAGCAAGGATGCTAATGATGGGACTGAA
CAAGCTTTGCTTGATGAATTGAATGCATTAGATGAACACCTCAAGAGTAAA
GGGCCTTATGTTACTGGGAAAACGATCACAGCTGTTGATTTGAGTCTGGCACCAAAGCTATACCATCTT
GAGGTGGCTCTTGGCCATTTTAAGAAGTGGACTGTTCCCGAAAGTCTGACTCATGTGCGTAACTACATGAAG
TCGTTTGAGAAAACCAAACCTGCTAAAGAAGAATACGTCGTTGCTGGA
TGGGCGCCAAAGGTTAATAGCGCATGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATTG AGATCTGTGT CAAAGCTGCT ACGGGTGCCC CTGATGTTCT TGGCGACTGT CCATTTTCCC AAAGGATTCT TTTGACTTTG GAAGAGAAGA AAGTCGCTTT CAAAACCCAT  CTCATTAACT TAGACAACAA ACCTAAATGG TTTCTTGAAG TGAACCCAGA TGGGAAAGTT CCTTTGGCCA AATTTGATGA GAATTGGATA TCTGATTCTG ATGTTATTGT GGGTCTTATT  GAAGAGAAGT ACCCTCACCC TTCACTTGCC ACTCCCCCTG AACTTGCCTC TGTGGGGTCA AAGATTTTCC CTAAATTTGT GGTATTTCTA AAGAGCAAGG ATGCTAATGA TGGGACTGAA  CAAGCTTTGC TTGATGAATT GAATGCATTA GATGAACACC TCAAGAGTAA AGGGCCTTAT GTTACTGGGA AAACGATCAC AGCTGTTGAT TTGAGTCTGG CACCAAAGCT ATACCATCTT  GAGGTGGCTC TTGGCCATTT TAAGAAGTGG ACTGTTCCCG AAAGTCTGAC TCATGTGCGT AACTACATGA AGTCGTTTGA GAAAACCAAA CCTGCTAAAG AAGAATACGT CGTTGCTGGA 
TGGGCGCCAA AGGTTAATAG CGCATGA 

Retrieve as FASTA