Entry information : HaDHAR14 (HanXRQChr13g0424161)
Entry ID 14250
Creation 2016-11-28 (Christophe Dunand)
Last sequence changes 2016-11-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaDHAR14 (HanXRQChr13g0424161)
Name (synonym) HaDHAR14 (HanXRQChr13g0424161)
Class Dehydroascorbate Reductase    [Orthogroup: DHAR003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaDHAR14
start..stop
S start..stop
HaDHAR02 366 2.15e-130 1..195 1..187
HaDHAR15 312 3.91e-109 22..204 62..236
ThasDHAR02 257 3.79e-87 22..204 69..243
AtDHAR03 249 2.56e-84 22..194 66..230
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14250' 'complement(join(189956680..189956892,189956984..189957110,189957187..189957345,189957433..189957523,189958265..189958328))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 189958265..189958328 62 N° 2 189957433..189957523 89 N° 3 189957187..189957345 157 N° 4 189956984..189957110 125
N° 5 189956680..189956892 211  
complement(join(189956680..189956892,189956984..189957110,189957187..189957345,1 89957433..189957523,189958265..189958328))


exon

Literature and cross-references HaDHAR14 (HanXRQChr13g0424161)
DNA ref. HanXRQ genome:   HanXRQChr13 (189958328..189956680)
Protein sequence: HaDHAR14 (HanXRQChr13g0424161)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   217
PWM (Da):   %s   24383.44  
PI (pH):   %s   8.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMLNRPLKSYMTKNLRYKSTYCPFTQRVLLTLEEKHLPYGLKLVDLGNKPAWFLSISPEGKVPVAKVDDKWIADSDVITQTVEEKFPDPSLVTPPESFCVHSCSFGSKIFSTYIGFLKSK
DANDGTEKALLNELSAFNDYIKENMG
GPFINRKDISAADLSLGPKLYHMEIALGHYKKWSVSDSLPHLKIYMKVHLSLLNCIKLSFCESSLNCYAL*

Retrieve as FASTA  
Remarks Duplication of HanXRQChr04g0116551
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGTTGAATAGGCCATTGAAGAGCTACATGACAAAGAATTTAAGGTATAAATCAACTTACTGTTATCTTTATGAATGCTCACAAGGATTATTGCAATTGTTTTTTTTTTTTTTTTTT
AATTTCTCTGTTTTTGAATATAAACGCTTAATGAGGTTATTGCTGACCCATTTACGTATAAATGGGTCGATTTGGGATATCTTCTATTTAACGGGTCGACGGGTAAACACTAAAACTTCA
CTAAAAGGAAAAGCAAAATAAGTATATATACACACACACAACATATATACGATTTTTTACGTTTTTAGGTTTGAATTATGTTCTCGGCCCATATTGTCGACTCCTATATTTTTTGAAACA
TTTGTAAAAAACACTGATACCATTTGTTGCTATCAATGTCATCTTTCGGTTATATCACGGAGTTCTATCAACTTCATAAATCAATTTCTTTGAGTTTGAATAATCAAAACCAAGTTAATA
CACACTAGAAAAAAATAAATATACATTGATATTAATTCAAACCTAAATACGTTAAAAAACGTTAAAAAATCTCCCATATTGTGCGCTTGTGATCAATATTGCCAATCTTTTACATGCAAG
TTTCTTTTGATTTTTAGTGTGGATATTCTAAACTAAAGTCTAATAGCATGTAGTTTAACATAAACGATTAGGAATGTTCATGAGCCAAAATGAGCCAAGCCATGGCTATTCAGGCTTCGC
TTGTTTGTAAATGAGCTAAGCCGAGTTGTCTTAGTTTATAAACAAATTTGGGTGCACAGTTATTTTTATATATCTGTTGTTTCAGGTGTCCGTTTACACAGAGAGTTTTGCTGACACTGG
AAGAGAAGCATCTTCCTTATGGCCTAAAGTTAGTTGATCTCGGTAACAAGCCAGCCTG
GTAATCATACAGTATTCCGTTTATAACATGTCGTGTTTTCAACCGTTCATAATATGATCTAC
GCATGACACTCTTGGTTTTACGTAGGTGTTTTTAAGTATTAGCCCAGAAGGTAAAGTCCCAGTGGCGAAAGTTGATGACAAATGGATAGCAGATTCCGATGTTATTACACAGACAGTAGA
GGAAAAGTTCCCCGACCCGTCACTGGTGACCCCACCTGAGAGCTTCTGTGTACACTCATGCTCTTT
GTCTCCCCTTTGTTCAGTTTACATTCATTTTTGCAAATTGATGTTGAATAATGG
TATTTCTGATTCATATATCTAGCGCGGGTCGAAAATCTTTTCGACATATATTGGCTTCTTAAAAAGCAAAGATGCGAATGATGGAACGGAGAAAGCTTTACTGAATGAACTCTCTGCTTT
CAATGATTACATCAAAGAAAATATGGGTTCT
GTTCTATCTCTCCACACACGCACATATATATCAAACTGTTTGTTGAATTAGGTTGCTGATTTTAAATTTTTTTCTCACGTGTTTGTTGA
AGGGGGTCCGTTTATCAACAGAAAGGATATCTCTGCTGCAGACTTGTCACTAGGTCCGAAGCTGTACCATATGGAGATCGCTTTGGGTCATTATAAGAAGTGGTCAGTCTCAGATTCACT
TCCCCATCTGAAAATATACATGAAGGTACACTTATCTTTGTTGAATTGCATAAAGTTATCTTTTTGTGAGAGCAGCCTTAATTGTTATGCTCTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGTTGAATAGGCCATTGAAGAGCTACATGACAAAGAATTTAAGGTATAAATCAACTTACTGTCCGTTTACACAGAGAGTTTTGCTGACACTGGAAGAGAAGCATCTTCCTTATGGC
CTAAAGTTAGTTGATCTCGGTAACAAGCCAGCCTG
GTTTTTAAGTATTAGCCCAGAAGGTAAAGTCCCAGTGGCGAAAGTTGATGACAAATGGATAGCAGATTCCGATGTTATTACACAG
ACAGTAGAGGAAAAGTTCCCCGACCCGTCACTGGTGACCCCACCTGAGAGCTTCTGTGTACACTCATGCTCTTT
CGGGTCGAAAATCTTTTCGACATATATTGGCTTCTTAAAAAGCAAA
GATGCGAATGATGGAACGGAGAAAGCTTTACTGAATGAACTCTCTGCTTTCAATGATTACATCAAAGAAAATATGGGTTCT
GGTCCGTTTATCAACAGAAAGGATATCTCTGCTGCAGAC
TTGTCACTAGGTCCGAAGCTGTACCATATGGAGATCGCTTTGGGTCATTATAAGAAGTGGTCAGTCTCAGATTCACTTCCCCATCTGAAAATATACATGAAGGTACACTTATCTTTGTTG
AATTGCATAAAGTTATCTTTTTGTGAGAGCAGCCTTAATTGTTATGCTCTTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAATT GCTCTTACCC AAAAGTGGAA GGTTTCGAGT GAACTTTGTG AACCATTTTG GGGTGTTGAG GTGAGGTTGG TAAGAAATAA GGACACTAGC ATTCAGAAGT AAAGATGATG  TTGAATAGGC CATTGAAGAG CTACATGACA AAGAATTTAA GGTATAAATC AACTTACTGT CCGTTTACAC AGAGAGTTTT GCTGACACTG GAAGAGAAGC ATCTTCCTTA TGGCCTAAAG  TTAGTTGATC TCGGTAACAA GCCAGCCTGG TTTTTAAGTA TTAGCCCAGA AGGTAAAGTC CCAGTGGCGA AAGTTGATGA CAAATGGATA GCAGATTCCG ATGTTATTAC ACAGACAGTA  GAGGAAAAGT TCCCCGACCC GTCACTGGTG ACCCCACCTG AGAGCTTCTG TGTACACTCA TGCTCTTTCG GGTCGAAAAT CTTTTCGACA TATATTGGCT TCTTAAAAAG CAAAGATGCG  AATGATGGAA CGGAGAAAGC TTTACTGAAT GAACTCTCTG CTTTCAATGA TTACATCAAA GAAAATATGG GTTCTGGTCC GTTTATCAAC AGAAAGGATA TCTCTGCTGC AGACTTGTCA  CTAGGTCCGA AGCTGTACCA TATGGAGATC GCTTTGGGTC ATTATAAGAA GTGGTCAGTC TCAGATTCAC TTCCCCATCT GAAAATATAC ATGAAGGTAC ACTTATCTTT GTTGAATTGC 
ATAAAGTTAT CTTTTTGTGA GAGCAGCCTT AATTGTTATG CTCTTTGA 

Retrieve as FASTA