Entry information : HaMDAR03 (HanXRQChr12g0377281)
Entry ID 14253
Creation 2016-11-28 (Christophe Dunand)
Last sequence changes 2017-11-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaMDAR03 (HanXRQChr12g0377281)
Name (synonym) HaMDAR03 (HanXRQChr12g0377281)
Class Monodhydroascorbate Reductase    [Orthogroup: MDAR001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaMDAR03
start..stop
S start..stop
LeMDAR03 749 0 4..435 3..433
ThasMDAR02 710 0 1..435 1..435
AtMDAR04 700 0 4..435 3..434
ThasMDAR04 690 0 4..433 3..432
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 104854328..104854381 54 N° 2 104854852..104854923 72 N° 3 104855488..104855539 52 N° 4 104855717..104855916 200
N° 5 104855992..104856211 220 N° 6 104856311..104856429 119 N° 7 104856509..104856634 126 N° 8 104857304..104857444 141
N° 9 104857511..104857834 324  
join(104854328..104854381,104854852..104854923,104855488..104855539,104855717..1 04855916,104855992..104856211,104856311..104856429,104856509..104856634,10485730 4..104857444,104857511..104857834)


exon

Literature and cross-references HaMDAR03 (HanXRQChr12g0377281)
DNA ref. HanXRQ genome:   HanXRQChr12 (104854328..104857834)
Protein sequence: HaMDAR03 (HanXRQChr12g0377281)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   435
PWM (Da):   %s   46813.28  
PI (pH):   %s   5.41
Sequence 476
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGEKSFKYVIVGGGVSAGYAAREFAKQGVQPGELAIISKEAVAPYERPALSKAYLFPEGAARLPGFHVCVGSGGEKLLPEWYTEKGIELILNTEIVKADLASKSLTSAAGDTFKYKILIIATGSTVLKLTDFKVEGADAKNILYLREIDDADQLVEAIKAKKNGKAVVVGGGYIGLELSAVLKINNFDVKMVYPEPWCMPRLFTADIAAFYEGYYEKKGVGIIKGTVASGFTKNDNGEVKEVKLKDGRVLEADIVVVGVGARPLTNLFKGQVEEDKGGIKTDASFKTSVPDVYAVGDVATFPMKMYGDIRRVEHVDHSRKSAEQAVKAIFASEQGKDIEPYDYLPYFYSRSFDLSWQFYGDNVGDAVIFGDHDPASAKAKFGSYWIKDGKVVGAFLEGGAPEENQAIAKVARAQPAATSLDALAKEGLEFASKI

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCGGAGAAAAGTCTTTCAAGTACGTCATCGTCGGCGGTGGTGTCTCAGCCGTGAGTTTTCACCTATCTCAATTTCATGATTCTTATAGCTAGATTGTTGTAGTATGTTTTCCGATCA
CTGATTTAGGCGCTGAGAACTGGTTACGATATGTATGTATAAATCTAAGAGGAACTGTGCGTATGTAAGGATCTGAATATTTTGTTTTGATGTATGCGTGTTAACAGAATTTCTATTGTA
TAGTTCTAGATACATACGAACCAAACGTTCAGATGTTGCGTTTATGTTCTATAACATGTTCGTTTGTCTTTGTTTATGTCGTGAAGTTGTTTGTTTGAAAGATAAATAAACTGAAAACAA
TGAATTGGCTTTTGTATCCGATCTGCTGGCTGCTTTGGTTAAGCCTTTAGGATTAGGATTTCACCTTGAAAATCTAACTATGATAGAAAATCATTTTATGGTATGGTTATTATTTAATTA
TACAGCTGGTTTCTATGGAAAATAATTCTGTGTTTGCGTGCAGGGTTATGCTGCCAGGGAGTTTGCAAAGCAAGGAGTCCAGCCAGGCGAGCTAGCAATCATTTCTAAGGAGGCGGTATG
CTCATCGGTTTTTGTCTCTTTCTTCTAATAATTGTATAAAGTTGATGTGGTCGAATATTCTGTATATAATACAAATACTATCTTTTAAATATGTCTGCCTGCCAGATTGTTAACTAATGC
ATTCGTAATTGAAGATATTTCTTATGTTGTCTGTATGTATGTATTCCCATCTTATGGTTCGATGATTTGAACTATTGGAGTAAAAGAAAAAAGTTGTTGCTTTAGCCATAATTAAATAGC
TAAAAAGCCTTACTAGAATTCATTGGCACAAGTACTAGTTGTTTGTTAGGGTGGTTGACAAGTAATCAGGGGTCTTTTTGAATTCTAATTTTGTAAGCTAAATATTAGGTTGTTAACAAT
CATGAGTAAAGACTGTTAAACTAATCGTTTTGGTCGATCCAAGATTTACCCCTCCTTGATTAAATGACCAAATGTAATAACTGTTTTGCAAATATGTCCACCTAAAGAATAGATTACATG
AAGCACAATGCTAAATCTGAGTTTATTATGTAGAACGATTATATGATTTTGCTAAGTTCAGTCTCTTTGGATCTTGTAGGTGGCTCCATATGAACGCCCTGCACTAAGCAAGGCGTATTT
GTTTCCTGAAG
GTAAGTTTTGTTATTTGCCTGCCTAATTAGGGACTGTCCAATCGGATAGTAAAAAGCTTTCAAGTTTTTTTTTTTTTGAGATTACACTACTCTTCAAACCAAGGAAAGC
TTCAACTTAAGTTCTGATGGTAATTCTATCATAAAAGCTGTAGTTTTGTAACTTGGTGAATCTTTCAGGAGCTGCCAGACTTCCAGGATTTCATGTCTGTGTTGGAAGTGGAGGAGAGAA
ACTATTACCCGAGTGGTACACAGAGAAAGGAATAGAGTTGATCCTTAACACGGAGATAGTAAAGGCAGATCTTGCTTCGAAATCGCTTACCAGTGCCGCCGGTGACACCTTCAAATATAA
AATTCTAATCATTGCCACTGGATCCACA
GTAAGCTCCGGAAAAGTAGCCAGCAGCCACCTCTTCTCTTCTTTTTTATATCTATAACTCTCAATCTACTTTCAGGTTCTGAAACTGACCGA
CTTCAAAGTGGAAGGGGCTGATGCCAAAAACATTCTTTATTTGAGAGAGATTGATGATGCTGATCAACTTGTAGAAGCTATCAAAGCAAAGAAAAATGGCAAGGCTGTTGTTGTCGGTGG
AGGATACATCGGTCTTGAGCTAAGTGCGGTTCTAAAAATTAACAACTTTGATGTTAAAATGGTTTACCCAGAACCATGGTGCA
GTAAGTCCAGTCCACACAGCTCTTTGTTCAATTTCTT
TACATATTTTTTGGCAAAACAAGTACCCGTGCCATAAACGTTTTATGTCATGTTTATACCAGTGCCTCGTCTATTCACTGCTGATATTGCTGCTTTCTACGAGGGTTATTATGAGAAAAA
GGGAGTGGGTATCATCAAGGGTACAGTCGCGTCCGGTTTTACCAAGAATGACAACGGAGAG
GTTTGTACGAATGAAACATAATCCCTTTGGATTCTCACTTTGTTTTCCTTTTGTAATAG
CTGCAGTTGCAACTTTTCAGGTAAAAGAAGTAAAACTTAAGGATGGAAGGGTGCTAGAAGCAGATATTGTGGTAGTTGGTGTTGGTGCTAGGCCCCTTACAAATCTGTTTAAAGGACAGG
TTGAAGAGGACAAAGGTGGAATTAAG
GTCTGTGTTCGATCTTTCTAGAATGAGTAGACTCGGGTTATGCTTTATCGATAACTGGTCAAACTTTTAAAATAGAGTTGATTACTGTTTTCGT
CCCTGTGATTTGTCAAAATCACTATTTTAGTCCATTAGTTTAAAAATTGTGATTTCAGTCCATTACTGAAATGGTTACGAAAGTGAAACCACAGGGACTGAAATCGCAATTTTTAAACTA
ATGGACCGAAATAGTGATTTTTGACAAACCACAGGGACGAAAACAGTAATCAACTCTTTAAAATAAATAAAGATCAGCTTACAAGGAAACACGTTGAAACTCCAAGTAGTATATTTTATT
TTTTTACTTTAGAAATAAAGATTATTTTTTAATATTTTTTTTTTGTGCTAAAAATTAAAATAATATAATTTATATTACATTAATAAAGAGGCAAATTATGTATATAAAATTGAGAAAATA
TAATTGGATAAAAATGGTTTCAGGTCAACCTAACCTGACCCATTTCGATCCAAGCCATACCAAGAAATTACCATTTTTTACCTCTCCATTACCCAACCCGCAGATTTGTAGTTTGTACAA
TTAAACTATAGTAAGGAGTAAGGACTGTATGTGACTAGGAACATTTGCTAGTATGAATGAATTTCACTTGTCCTATCTTTTTTGTTAAATTACAGACAGATGCATCTTTCAAAACTAGCG
TTCCTGATGTATACGCTGTTGGTGATGTTGCTACTTTCCCAATGAAAATGTACGGTGACATTAGAAGAGTTGAACATGTTGACCATTCCCGTAAATCTGCAGAACAAGCTGTGAAG
GTAT
TAGAAATTATTGAATTAACTAATGTAAATAAAGAAGTTGTTAACATGAACGTATTTATGCAGGCCATTTTTGCTAGTGAGCAAGGGAAGGATATCGAACCATATGATTACCTTCCATACT
TCTATTCGCGTTCATTCGATCTGTCATGGCAGTTTTATGGGGACAATGTTGGCGATGCTGTTATCTTTGGTGATCACGATCCAGCATCAGCGAAAGCCAAGTTTGGGTCATACTGGATCA
AGGATGGCAAGGTTGTGGGTGCGTTTTTGGAAGGTGGTGCACCCGAAGAGAACCAAGCCATAGCCAAAGTTGCTAGAGCCCAGCCTGCTGCCACCAGCTTGGACGCGCTTGCCAAGGAGG
GTCTGGAATTTGCCAGCAAGATCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCGGAGAAAAGTCTTTCAAGTACGTCATCGTCGGCGGTGGTGTCTCAGCCGGTTATGCTGCCAGGGAGTTTGCAAAGCAAGGAGTCCAGCCAGGCGAGCTAGCAATCATTTCTAAGG
AGGCG
GTGGCTCCATATGAACGCCCTGCACTAAGCAAGGCGTATTTGTTTCCTGAAGGAGCTGCCAGACTTCCAGGATTTCATGTCTGTGTTGGAAGTGGAGGAGAGAAACTATTACCCG
AGTGGTACACAGAGAAAGGAATAGAGTTGATCCTTAACACGGAGATAGTAAAGGCAGATCTTGCTTCGAAATCGCTTACCAGTGCCGCCGGTGACACCTTCAAATATAAAATTCTAATCA
TTGCCACTGGATCCACA
GTTCTGAAACTGACCGACTTCAAAGTGGAAGGGGCTGATGCCAAAAACATTCTTTATTTGAGAGAGATTGATGATGCTGATCAACTTGTAGAAGCTATCAAAG
CAAAGAAAAATGGCAAGGCTGTTGTTGTCGGTGGAGGATACATCGGTCTTGAGCTAAGTGCGGTTCTAAAAATTAACAACTTTGATGTTAAAATGGTTTACCCAGAACCATGGTGCA
TGC
CTCGTCTATTCACTGCTGATATTGCTGCTTTCTACGAGGGTTATTATGAGAAAAAGGGAGTGGGTATCATCAAGGGTACAGTCGCGTCCGGTTTTACCAAGAATGACAACGGAGAG
GTAA
AAGAAGTAAAACTTAAGGATGGAAGGGTGCTAGAAGCAGATATTGTGGTAGTTGGTGTTGGTGCTAGGCCCCTTACAAATCTGTTTAAAGGACAGGTTGAAGAGGACAAAGGTGGAATTA
AG
ACAGATGCATCTTTCAAAACTAGCGTTCCTGATGTATACGCTGTTGGTGATGTTGCTACTTTCCCAATGAAAATGTACGGTGACATTAGAAGAGTTGAACATGTTGACCATTCCCGTA
AATCTGCAGAACAAGCTGTGAAG
GCCATTTTTGCTAGTGAGCAAGGGAAGGATATCGAACCATATGATTACCTTCCATACTTCTATTCGCGTTCATTCGATCTGTCATGGCAGTTTTATG
GGGACAATGTTGGCGATGCTGTTATCTTTGGTGATCACGATCCAGCATCAGCGAAAGCCAAGTTTGGGTCATACTGGATCAAGGATGGCAAGGTTGTGGGTGCGTTTTTGGAAGGTGGTG
CACCCGAAGAGAACCAAGCCATAGCCAAAGTTGCTAGAGCCCAGCCTGCTGCCACCAGCTTGGACGCGCTTGCCAAGGAGGGTCTGGAATTTGCCAGCAAGATCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATCCCAATT TCAGTACCAG ATACATAAAA ACTCATCGAA ACCAATGGCC GGAGAAAAGT CTTTCAAGTA CGTCATCGTC GGCGGTGGTG TCTCAGCCGG TTATGCTGCC AGGGAGTTTG  CAAAGCAAGG AGTCCAGCCA GGCGAGCTAG CAATCATTTC TAAGGAGGCG GTGGCTCCAT ATGAACGCCC TGCACTAAGC AAGGCGTATT TGTTTCCTGA AGGAGCTGCC AGACTTCCAG  GATTTCATGT CTGTGTTGGA AGTGGAGGAG AGAAACTATT ACCCGAGTGG TACACAGAGA AAGGAATAGA GTTGATCCTT AACACGGAGA TAGTAAAGGC AGATCTTGCT TCGAAATCGC  TTACCAGTGC CGCCGGTGAC ACCTTCAAAT ATAAAATTCT AATCATTGCC ACTGGATCCA CAGTTCTGAA ACTGACCGAC TTCAAAGTGG AAGGGGCTGA TGCCAAAAAC ATTCTTTATT  TGAGAGAGAT TGATGATGCT GATCAACTTG TAGAAGCTAT CAAAGCAAAG AAAAATGGCA AGGCTGTTGT TGTCGGTGGA GGATACATCG GTCTTGAGCT AAGTGCGGTT CTAAAAATTA  ACAACTTTGA TGTTAAAATG GTTTACCCAG AACCATGGTG CATGCCTCGT CTATTCACTG CTGATATTGC TGCTTTCTAC GAGGGTTATT ATGAGAAAAA GGGAGTGGGT ATCATCAAGG  GTACAGTCGC GTCCGGTTTT ACCAAGAATG ACAACGGAGA GGTAAAAGAA GTAAAACTTA AGGATGGAAG GGTGCTAGAA GCAGATATTG TGGTAGTTGG TGTTGGTGCT AGGCCCCTTA  CAAATCTGTT TAAAGGACAG GTTGAAGAGG ACAAAGGTGG AATTAAGACA GATGCATCTT TCAAAACTAG CGTTCCTGAT GTATACGCTG TTGGTGATGT TGCTACTTTC CCAATGAAAA  TGTACGGTGA CATTAGAAGA GTTGAACATG TTGACCATTC CCGTAAATCT GCAGAACAAG CTGTGAAGGC CATTTTTGCT AGTGAGCAAG GGAAGGATAT CGAACCATAT GATTACCTTC  CATACTTCTA TTCGCGTTCA TTCGATCTGT CATGGCAGTT TTATGGGGAC AATGTTGGCG ATGCTGTTAT CTTTGGTGAT CACGATCCAG CATCAGCGAA AGCCAAGTTT GGGTCATACT  GGATCAAGGA TGGCAAGGTT GTGGGTGCGT TTTTGGAAGG TGGTGCACCC GAAGAGAACC AAGCCATAGC CAAAGTTGCT AGAGCCCAGC CTGCTGCCAC CAGCTTGGAC GCGCTTGCCA  AGGAGGGTCT GGAATTTGCC AGCAAGATCT GAGAGGTCTT TGGTTTCCAT TCATTTTCTT CAATTAGACT AAAGATGATG ATGATGAATA ACGTGTTTCA GCATTTATGA TTTGCTTTAG  TGTGTGTCTT CATGTTACAT TTGCATCTCC GTTTGGCTGT AATTTCTTCC CATAAAAAAT ATATTTAAAA AATGTATCTT ATGTTGAGAG TTTTATCAAT CTTTCAGTTA TATAGTTGTA  TTTTCTTAGC TTAATTTCTT CCCATAGTTG TATTTTCTTA GCTTAATTTC TTCCCAAATG ACATGATTTT GAAAAGTGGG ATGCATGAGT TTCTCGTGAC AAATCCAATC GCTATGTTGC 
TA 

Retrieve as FASTA