Entry information : HaDHAR18 (HanXRQChr14g0460811)
Entry ID 14254
Creation 2016-11-28 (Christophe Dunand)
Last sequence changes 2016-11-28 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaDHAR18 (HanXRQChr14g0460811)
Name (synonym) HaDHAR18 (HanXRQChr14g0460811)
Class Dehydroascorbate Reductase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaDHAR18
start..stop
S start..stop
ThasCPF03 84 3.92e-21 66..111 6..51
ThasCPF01 82 5.21e-20 62..111 64..114
HaCPF03 80 1.12e-19 65..111 3..49
ThasCPF04 79 2.49e-19 66..111 6..51
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14254' 'complement(join(169732232..169732322,169732560..169732631,169732758..169732951))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 169732758..169732951 192 N° 2 169732560..169732631 70 N° 3 169732232..169732322 89  
complement(join(169732232..169732322,169732560..169732631,169732758..169732951))


exon

Literature and cross-references HaDHAR18 (HanXRQChr14g0460811)
DNA ref. HanXRQ genome:   HanXRQChr14 (169732951..169732232)
Protein sequence: HaDHAR18 (HanXRQChr14g0460811)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   118 (297)
PWM (Da):   %s   13120.6 (31990.5)  
PI (pH):   %s   8.66 (8.20) Peptide Signal:   %s   cut: 26 range:26-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALNLSCCYHHHHFQSHSPPPTNVPILLSHRNNISISPKSPLTS
FHHKRHHSNLLVLATTMAT
NVQEDLPPALDSTSEPPSVFDGTTRLYISYTCPYAQRVWITRNCKALPLSHIVT

Retrieve as FASTA  
Remarks Partial and only 5'end
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCGTTAAATCTAAGCTGCTGCTACCATCATCATCACTTTCAATCTCACTCTCCGCCACCAACGAATGTTCCCATTCTTCTCTCTCATCGTAACAATATATCTATCTCCCCCAAA
TCCCCCTTAACATCATTTCACCACAAAAGGCATCATAGTAATCTGTTAGTTCTAGCAACGACAATGGCTACTAA
GTAAGTCACCTCTCTCTCTCTCCTGTAAGCAGTTGGGACGAAGGGA
TTATGTTGTATTTGAAGCATGATTGTAGACTATCTGTTGCTGATGTTTGTTTTGATTTTGATTTTGTTGGTTGTTGAAAGTGTGTGCAAGAGGATCTTCCACCAGCTCTTGATTCTACTT
CCGAACCACCTTCGGTTTTCGATGGAACTACTAG
GTAGTTATAACTCATACTCATACAGCTGTTTGTTGAAATGCCTGAATGAAACTAACTTATTTAGGTGGTCTATTCTCCCAAAATAG
TTCATAGTCCGGACTCGGTATCGGAGCTCGTTTTATTTTAGTTCAAGCTGTATTTGCTCTGGTTACAGTTTTAGATATATGCATTCTTAGCTAATTATCTGAAATTTGTTGATTTTCTAA
CCAAGAGCTTGGATTTTTTTGGTTTGGTTAGGTGTTGTACATATCTTACACTTGCCCGTATGCACAACGTGTGTGGATTACCCGCAACTGCAAGGCTCTCCCTCTCTCTCATATCGTTAC
TTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCGTTAAATCTAAGCTGCTGCTACCATCATCATCACTTTCAATCTCACTCTCCGCCACCAACGAATGTTCCCATTCTTCTCTCTCATCGTAACAATATATCTATCTCCCCCAAA
TCCCCCTTAACATCATTTCACCACAAAAGGCATCATAGTAATCTGTTAGTTCTAGCAACGACAATGGCTACTAA
TGTGCAAGAGGATCTTCCACCAGCTCTTGATTCTACTTCCGAACCA
CCTTCGGTTTTCGATGGAACTACTAG
GTTGTACATATCTTACACTTGCCCGTATGCACAACGTGTGTGGATTACCCGCAACTGCAAGGCTCTCCCTCTCTCTCATATCGTTACTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACGAGGTTCA CACACGAAGG CAAAGTCATC AGAACCAGCC AGATACGGTT TCCTGCTACA CCATTATCGA ATCACCAAAA TGGCTGCGTT AAATCTAAGC TGCTGCTACC ATCATCATCA  CTTTCAATCT CACTCTCCGC CACCAACGAA TGTTCCCATT CTTCTCTCTC ATCGTAACAA TATATCTATC TCCCCCAAAT CCCCCTTAAC ATCATTTCAC CACAAAAGGC ATCATAGTAA  TCTGTTAGTT CTAGCAACGA CAATGGCTAC TAATGTGCAA GAGGATCTTC CACCAGCTCT TGATTCTACT TCCGAACCAC CTTCGGTTTT CGATGGAACT ACTAGGTTGT ACATATCTTA 
CACTTGCCCG TATGCACAAC GTGTGTGGAT TACCCGCAAC TGCAAGGCTC TCCCTCTCTC TCATATCGTT ACTTAAAAAT CCGTCTTGGG AAAATTAATT TTATAATGT 

Retrieve as FASTA