Entry information : SmPrx50-1_126 (SmPrx50a_126)
Entry ID 1434
Creation 2009-11-10 (Christophe Dunand)
Last sequence changes 2009-11-10 (Christophe Dunand)
Sequence status complete
Reviewer Paula Nunes
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx50-1_126 (SmPrx50a_126)
Name (synonym) SmPrx50-1_126 (SmPrx50a_126)
Class Class III peroxidase    [Orthogroup: Prx069]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type Flower buds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx50-1_126
start..stop
S start..stop
SmPrx50-2_101 658 0 1..327 1..327
SmPrx74-2_39 460 1.32e-164 8..327 13..329
SmPrx74-1_88 459 5.98e-164 8..327 13..329
SmPrx36-1_2 407 4.79e-143 5..327 58..375
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '1434' 'complement(join(301114..301695,301775..302176))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 301775..302176 400 N° 2 301114..301695 580  
complement(join(301114..301695,301775..302176))


exon

Literature and cross-references SmPrx50-1_126 (SmPrx50a_126)
Literature JGI
DNA ref. Phytozome 12:   scaffold_126 (302176..301114)
Protein sequence: SmPrx50-1_126 (SmPrx50a_126)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (304)
PWM (Da):   %s   35261 (32805.6)  
PI (pH):   %s   8.96 (8.58) Peptide Signal:   %s   cut: 24 range:24-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTGMLLIVVFATLLVTQKPVTAQLSPLFYARSCPNLQALVRRVV
QQAVFQEPRMAASLLRLFFHDCFVQGCDASILLDDTSSFTGEKTAVPNRNSVRGFEVIDNIKSAVENACPRTVSC
ADILALAARESVLA
LQGPAWSVPLGRRDSTTASLASANNDIPAPTSTLSQLISKFQAKGLSIQDLVATSGAHTIGLARCVTFRDRLYNFSNTGAPDPNLNRFFLANLQQQCSPSTSSDNS
LSALDVRSPNRFDNSYFVNLQFNRGLLNSDQVLASTQNGVAQGLVSLYANRPFQFFRDFASAMVNMGNISPLTGSAGQIRTSCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 2). No EST. No prediction in JGI.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACTGGGATGTTGCTGATCGTCGTTTTTGCCACACTCCTCGTCACCCAAAAGCCCGTCACTGCGCAGCTCAGTCCCTTGTTCTATGCTCGGAGCTGTCCCAATTTGCAAGCCTTG
GTGAGAAGAGTAGTCCAGCAAGCCGTCTTTCAAGAGCCCAGGATGGCCGCTTCGCTGCTTCGCCTGTTCTTCCACGACTGCTTCGTCCAAGGCTGCGATGCCTCCATCCTCCTGGACGAT
ACCTCGAGCTTCACCGGGGAGAAGACCGCAGTCCCTAACCGGAACTCCGTCCGAGGATTCGAAGTTATTGACAACATCAAGTCGGCGGTTGAGAATGCATGCCCGAGAACAGTCTCCTGT
GCTGATATCCTCGCTCTTGCAGCTCGCGAAAGCGTCCTAGCC
GTAAGCCACCATATCGCCTTTTCCTTGTTTCTTAACGATTCATCCTAAAAGTTTCTGTTGATCACTTTGTCTCATATA
GTTTTGCAAGGACCAGCATGGAGTGTTCCTCTGGGACGCCGAGACAGCACCACTGCAAGCCTCGCCTCAGCCAACAATGATATTCCAGCTCCAACTTCGACACTCTCACAGCTCATCTCA
AAGTTTCAGGCCAAGGGATTGTCGATCCAAGACTTGGTCGCAACCTCGGGTGCTCATACGATCGGACTTGCTCGCTGCGTGACCTTCCGAGACCGTCTCTACAACTTCAGCAACACCGGA
GCTCCAGATCCGAATCTCAACAGGTTCTTCCTTGCAAACTTGCAGCAGCAGTGCAGCCCCTCGACTTCATCGGACAATAGCCTCTCCGCCCTCGATGTCAGGAGCCCGAATAGATTTGAC
AACTCGTACTTTGTCAACCTCCAATTCAATCGGGGACTTCTCAACTCGGACCAAGTTTTGGCATCCACGCAGAATGGTGTCGCTCAGGGGCTTGTAAGCTTGTATGCTAACAGGCCGTTT
CAGTTCTTCAGAGATTTTGCGTCGGCAATGGTCAACATGGGGAACATCAGTCCGCTCACGGGCAGTGCGGGACAAATCCGAACCAGCTGCCGCGTTGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACTGGGATGTTGCTGATCGTCGTTTTTGCCACACTCCTCGTCACCCAAAAGCCCGTCACTGCGCAGCTCAGTCCCTTGTTCTATGCTCGGAGCTGTCCCAATTTGCAAGCCTTG
GTGAGAAGAGTAGTCCAGCAAGCCGTCTTTCAAGAGCCCAGGATGGCCGCTTCGCTGCTTCGCCTGTTCTTCCACGACTGCTTCGTCCAAGGCTGCGATGCCTCCATCCTCCTGGACGAT
ACCTCGAGCTTCACCGGGGAGAAGACCGCAGTCCCTAACCGGAACTCCGTCCGAGGATTCGAAGTTATTGACAACATCAAGTCGGCGGTTGAGAATGCATGCCCGAGAACAGTCTCCTGT
GCTGATATCCTCGCTCTTGCAGCTCGCGAAAGCGTCCTAGCC
TTGCAAGGACCAGCATGGAGTGTTCCTCTGGGACGCCGAGACAGCACCACTGCAAGCCTCGCCTCAGCCAACAATGAT
ATTCCAGCTCCAACTTCGACACTCTCACAGCTCATCTCAAAGTTTCAGGCCAAGGGATTGTCGATCCAAGACTTGGTCGCAACCTCGGGTGCTCATACGATCGGACTTGCTCGCTGCGTG
ACCTTCCGAGACCGTCTCTACAACTTCAGCAACACCGGAGCTCCAGATCCGAATCTCAACAGGTTCTTCCTTGCAAACTTGCAGCAGCAGTGCAGCCCCTCGACTTCATCGGACAATAGC
CTCTCCGCCCTCGATGTCAGGAGCCCGAATAGATTTGACAACTCGTACTTTGTCAACCTCCAATTCAATCGGGGACTTCTCAACTCGGACCAAGTTTTGGCATCCACGCAGAATGGTGTC
GCTCAGGGGCTTGTAAGCTTGTATGCTAACAGGCCGTTTCAGTTCTTCAGAGATTTTGCGTCGGCAATGGTCAACATGGGGAACATCAGTCCGCTCACGGGCAGTGCGGGACAAATCCGA
ACCAGCTGCCGCGTTGTCAATTAA

Retrieve as FASTA