Entry information : SsteMnP23-2
Entry ID 14378
Creation 2017-05-11 (Catherine Mathe)
Last sequence changes 2017-05-11 (Catherine Mathe)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2017-05-16 (Marcel Zamocky)
Peroxidase information: SsteMnP23-2
Name SsteMnP23-2
Class Manganese peroxidase    [Orthogroup: MnP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation Secreted
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteMnP23-2
start..stop
S start..stop
SsteMnP23-3 753 0 1..380 1..380
SsteMnP23-1 744 0 1..380 1..380
SsteMnP04 698 0 1..380 1..380
SsteMnP16 691 0 1..380 1..380
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 419383..419540 158 N° 2 419593..419645 53 N° 3 419701..420231 531 N° 4 420280..420363 84
N° 5 420418..420589 172 N° 6 420647..420748 102 N° 7 420806..420848 43  
join(419383..419540,419593..419645,419701..420231,420280..420363,420418..420589, 420647..420748,420806..420848)


exon

Literature and cross-references SsteMnP23-2
DNA ref. JGI genome:   scaffold_22 (419383..420848)
Protein sequence: SsteMnP23-2
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   380 (361)
PWM (Da):   %s   39628.15 (37692.1)  
PI (pH):   %s   4.02 (4.04) Peptide Signal:   %s   cut: 20 range:20-380
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFASLISFVGLSVAAVQAANYKRVTCPDGVNTATNAACCAFFALRDDLQANLFDNQCGEDAHEVVRLTFHDAIAFSPALKAQGMPAGGGADGSMLIFPNVEPNFHANLGISDSVDALLPFLAKHNTISAGDLIQFGGAVALSNCPGAPRLEFMAGRPNATAPAPDGLIPEPQDTVTEILARMADGGEFTPDEVIALLASHSIARADHVDPTLDAAPFDSTPFDFDTQIFVEVLLRGVGFPGTGGNQGEAESPLPVTNGEDVGELRLLSDQTFARDSRTACTWQGFVNQQEKMANAFQAAMAKLALIGQDKSSMIDCSEVVPIPVPSSGKPATFPATKSNADIEQACASTPFPSLATDPGPVETLIPHCPDGSEDDCDDS*

Retrieve as FASTA  
Remarks Complete sequence from genomics (6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTTGCATCTCTCATCTCATTTGTTGGTCTCTCTGTCGCGGCTGTTCAAGCAGCAAACTACAAGCGTGTTACCTGCCCCGATGGTGTAAATACCGCTACCAACGCTGCTTGCTGT
GCCTTCTTCGCTCTCCGCGATGACCTACAGGCTAACTT
GTATGTATGCCATGCAAGCCGCAATATTTTTATTAATGTGGTTGTTCTGTAGGTTTGACAACCAGTGCGGTGAAGATGCTCA
TGAAGTCGTTCGCTTGACTTTCC
GTGAGTACTAGACCTTTCGGATCTATATATTATGTTCTCAATCCCAAATCACCAGACGACGCAATCGCCTTCTCCCCCGCTCTTAAAGCCCAAGGCA
TGCCTGCCGGTGGAGGAGCAGACGGTTCCATGCTCATTTTCCCCAATGTCGAGCCCAACTTCCATGCCAACCTCGGTATCTCCGACTCCGTCGATGCTCTCCTTCCCTTCCTCGCCAAAC
ACAACACAATCAGTGCTGGTGACCTCATCCAATTCGGAGGCGCTGTTGCACTTAGCAACTGCCCTGGAGCTCCTCGTCTGGAGTTCATGGCTGGTCGTCCCAACGCAACCGCACCCGCTC
CAGACGGTCTCATCCCAGAGCCCCAAGACACCGTCACGGAAATACTTGCCCGGATGGCGGACGGTGGAGAATTCACCCCCGATGAAGTTATTGCTTTGCTGGCATCACACTCCATTGCGC
GTGCAGACCACGTCGATCCGACATTGGATGCAGCTCCATTCGACAGCACTCCATTCGATTTCGACACTCAAATCTTCGTTGAAGTCTTACTCAGGGGTGTTGGGTTCCCCGGAACCGGTG
GCAACCAGG
GTAGGTACTGCTTTTAAGGGACACACATGAAAATTAACCGTTTTATAGGTGAAGCTGAGTCTCCTTTACCGGTGACCAATGGCGAGGATGTTGGTGAGCTTCGTCTCCTAT
CAGATCAGACATTTGCTCGTG
GTACGTAAACATTCCACATTAAATAATATATTTCCACTTAATATTCTCCGACAGACTCGAGAACTGCATGCACCTGGCAAGGGTTTGTGAACCAACAAG
AAAAAATGGCGAACGCTTTTCAAGCTGCCATGGCCAAGCTCGCCCTTATTGGTCAAGACAAATCCTCGATGATTGACTGCTCCGAAGTTGTTCCCATCCCTGTTCCCTCCAGTGGAAAGC
CTGCGAC
GTCAGTATCATTCTATGTACGATTTTCTCTAAATTACTAACCTGCGTTTCAATCTAGTTTCCCTGCTACCAAGTCAAATGCAGACATTGAGCAGGCTTGCGCTTCTACTCCAT
TCCCAAGTCTCGCCACTGATCCCGGTCCAGTAGAGACCTTGATTCC
GTGAGTACTATTAAATATTAATTTAAAAGATATTATTGACACGACTCTCAATTTCAGTCATTGCCCTGATGGTT
CTGAAGATGACTGTGACGACAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTTGCATCTCTCATCTCATTTGTTGGTCTCTCTGTCGCGGCTGTTCAAGCAGCAAACTACAAGCGTGTTACCTGCCCCGATGGTGTAAATACCGCTACCAACGCTGCTTGCTGT
GCCTTCTTCGCTCTCCGCGATGACCTACAGGCTAACTT
GTTTGACAACCAGTGCGGTGAAGATGCTCATGAAGTCGTTCGCTTGACTTTCCACGACGCAATCGCCTTCTCCCCCGCTCTT
AAAGCCCAAGGCATGCCTGCCGGTGGAGGAGCAGACGGTTCCATGCTCATTTTCCCCAATGTCGAGCCCAACTTCCATGCCAACCTCGGTATCTCCGACTCCGTCGATGCTCTCCTTCCC
TTCCTCGCCAAACACAACACAATCAGTGCTGGTGACCTCATCCAATTCGGAGGCGCTGTTGCACTTAGCAACTGCCCTGGAGCTCCTCGTCTGGAGTTCATGGCTGGTCGTCCCAACGCA
ACCGCACCCGCTCCAGACGGTCTCATCCCAGAGCCCCAAGACACCGTCACGGAAATACTTGCCCGGATGGCGGACGGTGGAGAATTCACCCCCGATGAAGTTATTGCTTTGCTGGCATCA
CACTCCATTGCGCGTGCAGACCACGTCGATCCGACATTGGATGCAGCTCCATTCGACAGCACTCCATTCGATTTCGACACTCAAATCTTCGTTGAAGTCTTACTCAGGGGTGTTGGGTTC
CCCGGAACCGGTGGCAACCAGG
GTGAAGCTGAGTCTCCTTTACCGGTGACCAATGGCGAGGATGTTGGTGAGCTTCGTCTCCTATCAGATCAGACATTTGCTCGTGACTCGAGAACTGCA
TGCACCTGGCAAGGGTTTGTGAACCAACAAGAAAAAATGGCGAACGCTTTTCAAGCTGCCATGGCCAAGCTCGCCCTTATTGGTCAAGACAAATCCTCGATGATTGACTGCTCCGAAGTT
GTTCCCATCCCTGTTCCCTCCAGTGGAAAGCCTGCGAC
TTTCCCTGCTACCAAGTCAAATGCAGACATTGAGCAGGCTTGCGCTTCTACTCCATTCCCAAGTCTCGCCACTGATCCCGGT
CCAGTAGAGACCTTGATTCC
TCATTGCCCTGATGGTTCTGAAGATGACTGTGACGACAGCTGA

Retrieve as FASTA