Entry information : SsteMnP23-3
Entry ID 14380
Creation 2017-05-11 (Catherine Mathe)
Last sequence changes 2017-05-11 (Catherine Mathe)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2017-05-16 (Marcel Zamocky)
Peroxidase information: SsteMnP23-3
Name SsteMnP23-3
Class Manganese peroxidase    [Orthogroup: MnP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation Secreted
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteMnP23-3
start..stop
S start..stop
SsteMnP23-2 753 0 1..380 1..380
SsteMnP23-1 748 0 1..380 1..380
SsteMnP04 694 0 1..380 1..380
SsteMnP16 692 0 1..380 1..380
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 853091..853248 158 N° 2 853301..853353 53 N° 3 853409..853939 531 N° 4 853995..854078 84
N° 5 854133..854304 172 N° 6 854362..854463 102 N° 7 854521..854563 43  
join(853091..853248,853301..853353,853409..853939,853995..854078,854133..854304, 854362..854463,854521..854563)


exon

Literature and cross-references SsteMnP23-3
DNA ref. JGI genome:   scaffold_41 (853091..854563)
Protein sequence: SsteMnP23-3
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   380 (361)
PWM (Da):   %s   39470.13 (37534.1)  
PI (pH):   %s   4.03 (4.05) Peptide Signal:   %s   cut: 20 range:20-380
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFASLISFVGLSVAAVQAANYKRVTCPDGVNTATNAACCAFFALRDDLQTNLFEGQCGEDAHEVVRLTFHDAIAFSPALKAQGMPAGGGADGSMLIFPNVEPNFHANLGISDSVDALLPFLAKHNTISAGDLIQFGGAVALSNCPGAPRLEFMAGRPNATAPAPDGLIPEPQDTVTDILARMADGGGFTPDEVIALLASHSIARADHVDPTLDAAPFDSTPFDFDTQIFVEVLLRGVGFPGTGGNQGEAESPLPVTSGEDVGELRLLSDQTFARDSRTACTWQGFVNQQEKMANAFQAAMAKLAVIGQDKSSLIDCSEVVPIPVPSSGKPATFPATKSNADIEQACASTPFPSLATDPGPVETLIPHCPDGSEDDCDDS*

Retrieve as FASTA  
Remarks Complete sequence from genomics (6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTTGCATCTCTCATCTCTTTCGTTGGTCTCTCTGTCGCAGCTGTTCAAGCAGCAAACTACAAGCGTGTTACCTGCCCCGATGGTGTAAATACCGCTACCAACGCTGCTTGCTGT
GCCTTCTTCGCTCTCCGCGACGACCTACAGACTAACTT
GTATGTATGTCATACAAATCATAATATTTTTATTGATGTAGTTATTCTATAGGTTTGAAGGCCAGTGCGGTGAAGATGCTCA
TGAAGTCGTTCGCTTGACTTTCC
GTGAGTACTGGACTTTTTGAATCGATATATTATGTTCTCAATCCCAAACCACCAGATGACGCAATCGCCTTCTCCCCCGCTCTTAAAGCGCAGGGTA
TGCCTGCCGGTGGAGGAGCAGACGGTTCCATGCTCATTTTCCCCAATGTCGAACCCAACTTCCATGCCAACCTCGGCATCTCCGACTCCGTCGATGCTCTCCTTCCCTTCCTCGCCAAAC
ACAACACAATCAGTGCTGGTGACCTCATCCAATTCGGAGGCGCTGTTGCACTTAGCAACTGCCCTGGAGCTCCTCGCCTGGAGTTCATGGCTGGTCGTCCCAACGCAACTGCACCTGCTC
CGGATGGTCTTATCCCAGAGCCCCAAGACACCGTGACGGACATTCTTGCCCGTATGGCGGACGGTGGAGGATTCACCCCCGATGAAGTTATTGCTTTGCTGGCATCACACTCCATTGCGC
GTGCAGACCACGTAGATCCGACATTGGATGCAGCTCCATTCGACAGCACTCCATTCGATTTCGACACTCAAATCTTCGTTGAAGTCTTACTCAGGGGTGTTGGATTCCCCGGAACCGGTG
GCAACCAGG
GTAGGTGCTGCTTTTGAGGGAAGGGACACAGATATGAAAATTAACCGTTTTATAGGTGAAGCTGAGTCTCCTCTGCCGGTGACCAGTGGCGAGGATGTTGGCGAGCTTCGT
CTCCTATCAGATCAGACGTTTGCTCGTG
GTACGTGAACATTCCACATAAAATAAAACAATTCCACTTAATATTCTCCGACAGACTCGAGAACTGCATGCACCTGGCAAGGGTTCGTGAAC
CAACAAGAAAAAATGGCGAACGCTTTCCAAGCTGCCATGGCCAAGCTCGCCGTTATCGGTCAAGACAAATCCTCGCTGATTGACTGCTCCGAAGTTGTTCCCATCCCTGTTCCTTCCAGT
GGAAAGCCTGCGAC
GTCAGTATCATTCTATGTACGATTTTCTCTAATTTACTAACAGGGGTTTCAATTCAGTTTCCCTGCTACCAAGTCAAATGCAGACATTGAGCAAGCTTGCGCTTCT
ACTCCATTCCCAAGTCTCGCCACTGATCCCGGTCCAGTAGAGACCTTGATTCC
GTGAGTATTATTAAACATTAATTTAAAGGACATTATTGACACTACTCTCAATTTCAGTCATTGCCCT
GATGGTTCTGAAGATGACTGTGACGACAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTTGCATCTCTCATCTCTTTCGTTGGTCTCTCTGTCGCAGCTGTTCAAGCAGCAAACTACAAGCGTGTTACCTGCCCCGATGGTGTAAATACCGCTACCAACGCTGCTTGCTGT
GCCTTCTTCGCTCTCCGCGACGACCTACAGACTAACTT
GTTTGAAGGCCAGTGCGGTGAAGATGCTCATGAAGTCGTTCGCTTGACTTTCCATGACGCAATCGCCTTCTCCCCCGCTCTT
AAAGCGCAGGGTATGCCTGCCGGTGGAGGAGCAGACGGTTCCATGCTCATTTTCCCCAATGTCGAACCCAACTTCCATGCCAACCTCGGCATCTCCGACTCCGTCGATGCTCTCCTTCCC
TTCCTCGCCAAACACAACACAATCAGTGCTGGTGACCTCATCCAATTCGGAGGCGCTGTTGCACTTAGCAACTGCCCTGGAGCTCCTCGCCTGGAGTTCATGGCTGGTCGTCCCAACGCA
ACTGCACCTGCTCCGGATGGTCTTATCCCAGAGCCCCAAGACACCGTGACGGACATTCTTGCCCGTATGGCGGACGGTGGAGGATTCACCCCCGATGAAGTTATTGCTTTGCTGGCATCA
CACTCCATTGCGCGTGCAGACCACGTAGATCCGACATTGGATGCAGCTCCATTCGACAGCACTCCATTCGATTTCGACACTCAAATCTTCGTTGAAGTCTTACTCAGGGGTGTTGGATTC
CCCGGAACCGGTGGCAACCAGG
GTGAAGCTGAGTCTCCTCTGCCGGTGACCAGTGGCGAGGATGTTGGCGAGCTTCGTCTCCTATCAGATCAGACGTTTGCTCGTGACTCGAGAACTGCA
TGCACCTGGCAAGGGTTCGTGAACCAACAAGAAAAAATGGCGAACGCTTTCCAAGCTGCCATGGCCAAGCTCGCCGTTATCGGTCAAGACAAATCCTCGCTGATTGACTGCTCCGAAGTT
GTTCCCATCCCTGTTCCTTCCAGTGGAAAGCCTGCGAC
TTTCCCTGCTACCAAGTCAAATGCAGACATTGAGCAAGCTTGCGCTTCTACTCCATTCCCAAGTCTCGCCACTGATCCCGGT
CCAGTAGAGACCTTGATTCC
TCATTGCCCTGATGGTTCTGAAGATGACTGTGACGACAGCTGA

Retrieve as FASTA