Entry information : HaGrxC11(HanXRQChr08g0221321)
Entry ID 14415
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-02-03 (Catherine )
Peroxidase information: HaGrxC11(HanXRQChr08g0221321)
Name HaGrxC11(HanXRQChr08g0221321)
Class CGYC Grx    [Orthogroup: GrxC002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC11
start..stop
S start..stop
HaGrxC01 184 1.2e-62 5..93 9..97
HaGrxC17 182 4.84e-62 5..93 9..97
HaGrxC04 180 3.9e-61 5..93 9..97
HaGrxC19 179 6.82e-61 5..93 9..97
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14415' 'complement(join(48774957..48775042,48775124..48775222,48775316..48775400,48775446..48775457))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 48775446..48775457 10 N° 2 48775316..48775400 83 N° 3 48775124..48775222 97 N° 4 48774957..48775042 84
complement(join(48774957..48775042,48775124..48775222,48775316..48775400,4877544 6..48775457))


exon

Literature and cross-references HaGrxC11(HanXRQChr08g0221321)
Protein sequence: HaGrxC11(HanXRQChr08g0221321)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   93 (298)
PWM (Da):   %s   9876.96 (32837.7)  
PI (pH):   %s   5.06 (9.78) Peptide Signal:   %s   cut: 25 range:25-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNDATWCGYCKSVKKLFSELNVSYKVIELDEESDGGEIQSTLKEWTGQSIVPNVFIGGKHIGGSDAIMEKHRAGKLVPLLTEAGAIANASAQL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGATGCTGTGTGATTAGGAATTAAGAAATTTTAACTTGATTTTGGCAGCAAGACACTTGGTGTGGCTATTGCAAGAGCGTGAAGAAACTGTTCTCCGAGCTTAATGTGTCCTACA
AGGTTATCGAACTAGATGAAGAAA
GTAAGTAGTGACTTTTGACTCTTTTGATGAATTGATTCATATCGGAGTTTGTATCAATAACATTTGAAGAAGTAATATGCATGGATTTGATAGGTG
TGATGGAGGTGAAATCCAATCCACTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCTAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCGGATG
GTAAGTTGTTTGAGCAATTTTG
TGTTTGATTTTTAGTGTTTGTTGATGGCGGATTGATTGATATTGTGGTCTTTTATGCAGCTCTATTATGGAGAAGCATCGAGCTGGGAAGCTGGTGCCGTTGCTAACCGAAGCAGGTGCC
ATTGCGAATGCCTCTGCACAGCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGATGCTACTTGGTGTGGCTATTGCAAGAGCGTGAAGAAACTGTTCTCCGAGCTTAATGTGTCCTACAAGGTTATCGAACTAGATGAAGAAAGTGATGGAGGTGAAATCCAATCC
ACTCTAAAGGAGTGGACCGGTCAGAGTATTGTTCCTAATGTATTCATAGGTGGGAAGCACATTGGTGGCTCGGATG
CTATTATGGAGAAGCATCGAGCTGGGAAGCTGGTGCCGTTGCTA
ACCGAAGCAGGTGCCATTGCGAATGCCTCTGCACAGCTCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGATG CTACTTGGTG TGGCTATTGC AAGAGCGTGA AGAAACTGTT CTCCGAGCTT AATGTGTCCT ACAAGGTTAT CGAACTAGAT GAAGAAAGTG ATGGAGGTGA AATCCAATCC  ACTCTAAAGG AGTGGACCGG TCAGAGTATT GTTCCTAATG TATTCATAGG TGGGAAGCAC ATTGGTGGCT CGGATGCTAT TATGGAGAAG CATCGAGCTG GGAAGCTGGT GCCGTTGCTA 
ACCGAAGCAG GTGCCATTGC GAATGCCTCT GCACAGCTCT GA 

Retrieve as FASTA