Entry information : HaGrxC13 (HanXRQChr10g0280311)
Entry ID 14417
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC13 (HanXRQChr10g0280311)
Name (synonym) HaGrxC13 (HanXRQChr10g0280311)
Class CGYC Grx    [Orthogroup: GrxC003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC13
start..stop
S start..stop
HaGrxC24 239 2.73e-82 8..171 1..164
ThasGrxC05-2 196 6.1e-65 1..169 3..177
AtGrxC05 190 1.15e-62 1..169 1..167
ThasGrxC05-1 188 3.76e-62 1..169 3..167
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14417' 'join(12177827..12178104,12178181..12178254,12180076..12180150,12180834..12180860,12181287..12181351)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 12177827..12178104 276 N° 2 12178181..12178254 72 N° 3 12180076..12180150 73 N° 4 12180834..12180860 25
N° 5 12181287..12181351 63  
join(12177827..12178104,12178181..12178254,12180076..12180150,12180834..12180860 ,12181287..12181351)


exon

Literature and cross-references HaGrxC13 (HanXRQChr10g0280311)
DNA ref. HanXRQ genome:   HanXRQChr10 (12177827..12181351)
Protein sequence: HaGrxC13 (HanXRQChr10g0280311)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172
PWM (Da):   %s   18508.64  
PI (pH):   %s   9.92
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATSSHLTTSSLTSVSLSTTSLSHFPNSPSSLSFTTIQYPKPLYKTTTTRTTKHGGLKIHAMTASFGSRLEESVKKTVTDNPVVVYSKTWCSYSSEVKSLFNRLGVEPLVVELDQGAQG
PQLQKVLERLTGQHTVPNVFI
GGKHIGGCTDTVKLHRKGELEGLLAEAKKA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCAACTTCTTCTCATCTTACTACTTCATCCCTCACCTCTGTTTCTCTCTCTACCACCTCTCTCTCTCACTTCCCCAACTCTCCCTCTTCCCTTTCATTCACCACCATTCAATAT
CCAAAACCATTATATAAAACAACCACCACCAGAACAACAAAACATGGTGGGCTCAAGATCCACGCCATGACAGCTTCATTCGGATCTCGATTAGAGGAGTCTGTCAAGAAAACCGTCACT
GATAATCCAGTCGTCGTCTATTCCAAAACCTGGTGTTC
TCGTAAGTTCACTTAGGGTTTTCTCTTTTCATATTTTGTAATTCATTTATTTCAGACTTTTTTGGTTTGATTGTGAAGGTAT
TCTTCTGAGGTGAAATCGTTGTTTAATCGGCTCGGTGTGGAGCCGCTTGTTGTTGAATTGGACCAGATGG
GGGTAAGTGTTATTGTTTTTTATATATGTATTTGGGGAAAAAGTGAAATA
AAGAGTTGGAAGTTAAATTGATCTTGTAGGTTAGGTTTAGAAGTTTGTTTGATTAGGGTTTGGTGTACTTTTGTTATTGTAATTAGGGTTTGGATTTGAGTTTAAACATTTGGTGCAGCT
GTTATAGTCTTTAAGTTTCGAAAACTTTAATCATACATTGAAAATATCTGAAAGTGAATTAGAGTGATACGGACTGAAACCATTGCTAGGTATGGGACTCGTCCCACATCAGTAGTATGG
GTAACGAATGTGGGGTTTATAGACCAAATGGGCTCCATCACCCACCAGACTAGTCTTTTGGAATGACACGAGTTCTCTTGTAGTCCTGTTTGGGCTGTAACTTAGAGTCTTGAAACCATT
GTAAGCTTTTAAGAAGGTATACCATGTTATTAAGTTAATTTGGAGATTTTTGGTATTGGGGAGCTTTTTTTTTTTTTTTTTTTTTTTTTTACAGAAATGTGAATTCAAGGTGTGTACGTC
ATTTGTTTCGTTTAAATCGTATGTAATATGCACATACTGTATATATAGTCAAGATTTTTTGATTAAATCCAACATGCTATGCGTATGTTATCTTGAAGTCTACATAATGTTAGAAGCCGA
TTTGACTTTTGAGACAACTAATCTCCCAAGAACATTAGAGAAGAACAAGAACAACTTTGAATCTATTTTTTTTCTTATATACATAGTTGTTAATGGCGAATAACGACAAATAGCGATAAG
GTACCTATATGCTACATAGCGAATAGCGATAAATAGCGGGGCTATTTTATAAATAGCGATACACTAGAAAAAGAATTTTGAAAATTTTTATATGTATATTATATCAAAGTACCCTGGTAT
ATACGCTATTTTACATGAATATTTAACAAAAAACCTAAAATCCAGCTATTTTATAGCTATATTTAGTTGCTATTTATATTGAGAAAAAAACAAAAAATAAAATAAAATTGAAGTCCGCTA
TCCATCGCTACAGACCATATAGCGAGCATGGACCTATAACCACGCTATTCGCTATCGACCGTGGCGATCGCTATTGACAACTACGCTTATATAGGCTTACAAATAAAGAAGAGAACAACT
AAACTAATCCCATTACACCCACTACTTCTAAACTATAACACTAAATAAAAGGAAACCAAATGGAACTATTGAGCTATGCAGTTAATCGCGGCGCTATAGTAGCGGTGCTATAGCGTCGAT
GTAGCGGTTATCGGTGGTAGCTCAAAATATCGGTTTGTAATATCGGTGTTATCTCGGACAGCGATTATATCGGCTATAAACACCGATATATCGCCGATATTTTGTATAATCTATATCGGT
TGTCTCGCCGATATCTCGTCTCGGTCAATTTTTTACATTTTTTTTTATACAAAACTGCATTTCACAGCAAAAAAAAGCGAAGTTTAAATGGTGCATAAATTACCGATATCCCACCGCGAT
AAACGATATCTCAAATATCGGTCCTTGACCGGTAACCGATATTTTTCCGCATTAACTGCATAGCTATTGAGCTAAAGCATGTGAACGTGAGGTGACTGCTGCATAAAGTATGGTGGGCTA
CATATCACATAACCACAACTTAATAAACGAATATATTCTTTTTAGTTGGAAACTGAAGAATCTCATTTCCCTATACCTTGAAGGCGCCTTAAATGTGATTATGTGAAGTATTATACAATA
TACATACATGAACTATAATATTGAGGCAATTTTGAAAATTAACTGTTAGGACTTAGAAATACTGAATGTAGTTTTATCGTTTTCTTTTCTCAGGTGCACAAGGACCTCAGCTACAGAAGG
TTCTTGAACGGCTTACTGGGCAGCATACCGTTCCAAATGTTTTTATTG
TGGTATGTTGTAGTTGCATTAAGAATCTCATATGATTCTCCACTTGAGAACTAAGTATGCTCTAATTTGTAT
TGAACTAACCTCGAACATAGCAGTTATTGCCTAAATTTTATATTGTGCCCGAATTTGCATGATATAAAATGTAATAGGCGTGGTGATTTCGACCCATTTAGTATATACGGGTCGAGTTGG
GCTATGTTTTGTCTGAAATGGAAAAGGGAACAAGTCAAATGGGTTAAAATTGCGCAAAAGTGAATTTAAGTGCATACAACCTCTAAAGAAAAAAAATTGAATTATTTTTGTAATGATTTA
TCTTCTTATTTTGTAATTATATAGTAAACACATTAATTACTTATTAAGGCATAAAGGAAAAAAAAATGGACAAAGCGTCATGAGAATCTGACTCAACCTGTCGACTCACCCATTTTGCCA
CCGCTAAAACATATATTTTTTTTCGTAGCGACAGACAATTTAGGATATGTGTCTGCTGCTGAATATGATGCAGTAAATGCTGAGTGCTGACCTTCCATCACTTTTTTCACAATATTAACA
TTTAACAACACTCAATAGAAGAAATATTGAAATGAAAATAGAAATAAAATATATCTACAGTAGCGTTCAGTATAAATTTTGTGCTTTAATTTCTTATTCTAATTTGTTCATTTATCTTGT
TCTGTGATAACAGGGGGCAAACACATCGGCGGTTGTACGGGGGTACCTTTTTTACCATATGCTTTTTGGCTACTTCATCTATCAACTATTCCTGTCGTTTTCGTTCTCTCTGGATATCAT
TATGCATGATTATGCAAACACGTTATTTTTCGTTTAAAGATTCGGGAAAATAGTTTGTGTTAAAATCGGTAATCACATGAAACCAAAATCATATATGACAGTATACACATGATTTAACAT
CCATAGATGTTGATAGAGACATTTTATTTTGTGATCGTGAATTATTTACGTTACAAGTCATATCTACTTAGAAAACAAGGATGACTGTCCTAGCTGTATATGTAAGCGTTATCATTATGA
TTTATTTACCTTATAAGTCACATTTACTTACAACAATAGCCGATCTTTTCGATCTATGATGTTGTATAATAGTATAATACTGCAATGTCGTTTTGTGATCCGGTGCAGATACCGTTAAGT
TACATAGGAAAGGGGAACTTGAAGGTTTGCTGGCAGAGGCAAAAAAGGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCAACTTCTTCTCATCTTACTACTTCATCCCTCACCTCTGTTTCTCTCTCTACCACCTCTCTCTCTCACTTCCCCAACTCTCCCTCTTCCCTTTCATTCACCACCATTCAATAT
CCAAAACCATTATATAAAACAACCACCACCAGAACAACAAAACATGGTGGGCTCAAGATCCACGCCATGACAGCTTCATTCGGATCTCGATTAGAGGAGTCTGTCAAGAAAACCGTCACT
GATAATCCAGTCGTCGTCTATTCCAAAACCTGGTGTTC
GTATTCTTCTGAGGTGAAATCGTTGTTTAATCGGCTCGGTGTGGAGCCGCTTGTTGTTGAATTGGACCAGATGGGTGCACAA
GGACCTCAGCTACAGAAGGTTCTTGAACGGCTTACTGGGCAGCATACCGTTCCAAATGTTTTTATTG
GGGGCAAACACATCGGCGGTTGTACGGATACCGTTAAGTTACATAGGAAAGGG
GAACTTGAAGGTTTGCTGGCAGAGGCAAAAAAGGCATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATCTTCCAT CCGTTGGCTT TTACGCAAAG AAAAGGTTCA AATTAGACGC AAAGGCCACC TCACCTAACA AGAAAAAGCC CCTTTGAGAT CACCACATAA AAAGTGTCAC TGACAGAAAC  ACACACAGAC CAAAAGGAAC AACCATCCTC ATCAATGGCA GCAACTTCTT CTCATCTTAC TACTTCATCC CTCACCTCTG TTTCTCTCTC TACCACCTCT CTCTCTCACT TCCCCAACTC  TCCCTCTTCC CTTTCATTCA CCACCATTCA ATATCCAAAA CCATTATATA AAACAACCAC CACCAGAACA ACAAAACATG GTGGGCTCAA GATCCACGCC ATGACAGCTT CATTCGGATC  TCGATTAGAG GAGTCTGTCA AGAAAACCGT CACTGATAAT CCAGTCGTCG TCTATTCCAA AACCTGGTGT TCGTATTCTT CTGAGGTGAA ATCGTTGTTT AATCGGCTCG GTGTGGAGCC  GCTTGTTGTT GAATTGGACC AGATGGGTGC ACAAGGACCT CAGCTACAGA AGGTTCTTGA ACGGCTTACT GGGCAGCATA CCGTTCCAAA TGTTTTTATT GGGGGCAAAC ACATCGGCGG  TTGTACGGAT ACCGTTAAGT TACATAGGAA AGGGGAACTT GAAGGTTTGC TGGCAGAGGC AAAAAAGGCA TAATTCTACT CTTTACTCCA GATGTGTTGT ATCAATAAGA AATAGTTGTC  TGATTATTTT TTTTTTTCAC AAATTTTAAA GCTGCACAAT TGTTTTATTC TCAAACAATG ATACCTTTTA TTTTAATTTG TGGCACTTGT CTTGTAGATT AAAAAGATGT AATTGGTATG 
ATAGTGAACA TATATGCATA TGTCATTGGC AAATCTTTTT CATTAAGATG TATAATCGTA AATATGTTGC TCAAACAGGA TTTGAGAGAT T 

Retrieve as FASTA