Entry information : HaGrxC23HanXRQChr15g0463031
Entry ID 14427
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC23HanXRQChr15g0463031
Name HaGrxC23HanXRQChr15g0463031
Class CGYC Grx    [Orthogroup: GrxC002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC23
start..stop
S start..stop
HaGrxC01 179 3.54e-60 38..127 8..97
HaGrxC11 177 1.49e-59 39..127 5..93
HaGrxC17 177 1.61e-59 38..127 8..97
HaGrxC04 175 9.21e-59 38..127 8..97
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14427' 'join(322648..322757,323743..323831,323921..324019,324779..324864)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 322648..322757 108 N° 2 323743..323831 87 N° 3 323921..324019 97 N° 4 324779..324864 84
join(322648..322757,323743..323831,323921..324019,324779..324864)


exon

Literature and cross-references HaGrxC23HanXRQChr15g0463031
DNA ref. HanXRQ genome:   HanXRQChr15 (322648..324864)
Protein sequence: HaGrxC23HanXRQChr15g0463031
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   127
PWM (Da):   %s   13636.93  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSLWSRTQQQTSKEEIDMALSKAKQIVSDNPVVVFSKTWCGYCKGVKKLFSELNVSYKVIELDESDGGEIQSALKEWTGQSTVPNVFIGGKHIGGSDAVMEKHRAGKLVPLLTEAGAIA
NTSAQL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGCCTGTGGAGCAGAACACAACAACAAACATCCAAAGAAGAAATCGATATGGCTCTTTCCAAAGCTAAGCAAATCGTTTCCGATAATCCCGTCGTCGTCTTCAGAGGTTTCTCT
TCATTCAGAATTTCAATTCAGTTACATGATGCTGTTTTGTTTATTTAATACAACTTTTCATTGAATTTTTAAACCTAATCGCATGTTTTACAGAAACAACAGTTCACTAAATTTAGTTTT
TTCCACAAATCGTGAAAGGTTTTCGATTGGTTTGCGTTGCTGAATGATGTTATATTCATCATAGATTAGTATTAAGAAATTTAATTTGAGTTTGCTGCTAAATAACTAGTGTGTGTTACT
GGAAGAACAGTAAACTAAACTTTGTTTTTCCGACAATTTGTGAAAGTATAGATGCTGTTTCAAAACAGCCGTTTCTCTCGATCGATTTGTTTTGCAGAATGATGTTGTGCTCATCATAGA
TTAATCGCTAATCTCTCAGAAGTTTTGCTAGAAGAACAGTTAGTTAACTAACTTGAGTTTTTTTCCTACAAATCGTGAAAGTATATATGTAAAACAATCGTTTCCGATCGGTTTGTCTTG
CAGATGTTGTGTTTATCGTGATTAGGCCGCAGAAGAGTTAACTAACTTGAGTTTTTCCGATAAATCGTAGAAGTATAGATGCAAAATGATCGCTTCTCGATCGGTGTGACCCGCTGAATG
ATGTTAAATAATAAGTGTTGCTAGAAGAACACTTAACTAACTTGAATTTTTTTTCTCGACAAATCGAGAAAAGTATAGATGCAAAACAATCGGTTCTGGATCGATTTGTGTTGTTGAGTG
ATGTTGCGTTCATCATAGATTAGTCTCTAATCTCTCAGATCAACAATTTAGAAATACTGCTGAATAACAAGTGTTCCTGGAAGAACAGTTGACTAAGTTTTGTTTTTCCAAAAAATAGTG
AAGAAAGTATAGATGCAAAACAACCGTTTTCGATAGGTTTATCTTGCTGAATGATGTTGTGTTCATCGCCAATCATCTATAGATTAGTCGCTAATCTCTCTGATCAGGAATTAAGAAACT
TAACTTGATTTTGGCAGCAAGACTTGGTGTGGATATTGCAAGGGCGTGAAGAAACTGTTCTCCGAGCTTAACGTGTCCTACAAGGTTATCGAACTGGATGAAGAAAAAGTAAGTTTTGAA
TCTTTTCATAAATTGATTTACATATCTGCATTTGTATCTAATAAAATTTGAAGAACTAATATATATGGATTTGATAGGTGATGGAGGTGAAATCCAATCCGCTCTAAAGGAGTGGACCGG
TCAGAGTACTGTTCCTAATGTGTTTATAGGTGGGAAGCATATTGGTGGCTCGGATG
TGGTGAGTTCTTTGAGCAATTTCGTGTCAGTTTTGAGTGATTGTTGATGGCGGATTTAGGGTTG
TAAACGAACCGAACATTCACCGAACAGTTCGTGAACATTTCGGTGGGAAGTTCGTTTATGTTCGTTCGATTAGCTTAACGAACGAACACGAACAAAAAATTTAGTTTGGTTAGCTTAGCG
AACGAACACAAACAAAGGTCTCGTTTGTTCGACTGCGTTCGTGAACGTTCGGTAATGTATTCGGTTACGTTCGTTCATGTTCGTTTGTTTGATTATATTAGAAAAACAATAAATAATAAA
CCTTTTATCTAAACATATTGAAAACTTGAAACCTTGTTTTTTTTCTAAATTAGTTAAAATTTGGACATTCAAGACATTTTTTGGGATAATTATGTCTAAGTTAGTTAAACGTGATTCATC
GTTTGGTGGTTGTAGTACACTTCTTGTGTTTTGATTTATCATTTGACGGTATTGTATTTAACTACTTATGTCCAATGTTTAATGTTAACAATGTTTTTATCTTTTATTTTCAAGTTAAAT
ATTCGTTTTTATTCATCGGCGTTCGTCTGTGTTCGAGACCAGTGTTCACGAACAACTGAATTTCCTTGACGAACGAAGACGAACATAAAGTGTTCATGAATAGTTCGCAAACATGTTATT
TTTCTTAACAAACGAACGCGAACATGGCCTTGTTCGAGTTCTTTCGGTTCGATTACAGCCCTAGGCGGATTGATTGATATTGTGGTCTTTTTTGCAGCTGTTATGGAGAAGCATCGAGCT
GGGAAGCTGGTGCCGTTGCTAACTGAAGCAGGTGCCATTGCGAATACCTCTGCACAGCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGCCTGTGGAGCAGAACACAACAACAAACATCCAAAGAAGAAATCGATATGGCTCTTTCCAAAGCTAAGCAAATCGTTTCCGATAATCCCGTCGTCGTCTTCAGCAAGACTTGG
TGTGGATATTGCAAGGGCGTGAAGAAACTGTTCTCCGAGCTTAACGTGTCCTACAAGGTTATCGAACTGGATGAAGAAA
GTGATGGAGGTGAAATCCAATCCGCTCTAAAGGAGTGGACC
GGTCAGAGTACTGTTCCTAATGTGTTTATAGGTGGGAAGCATATTGGTGGCTCGGATG
CTGTTATGGAGAAGCATCGAGCTGGGAAGCTGGTGCCGTTGCTAACTGAAGCAGGTGCCATT
GCGAATACCTCTGCACAGCTCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GACTTTCTAG ATGAAGTCAG CATCATTCCG TGTAAACGCC AAGTGGCCAT ACACTAAGCA AACGCCGGCT TCATACACAT CTTCTTTTCG GTTGCTTGCA CAATAAGCAC CATTTCTATT  TCTATTCTAG GATTTATAAA TAAATGGGAA GCCTGTGGAG CAGAACACAA CAACAAACAT CCAAAGAAGA AATCGATATG GCTCTTTCCA AAGCTAAGCA AATCGTTTCC GATAATCCCG  TCGTCGTCTT CAGCAAGACT TGGTGTGGAT ATTGCAAGGG CGTGAAGAAA CTGTTCTCCG AGCTTAACGT GTCCTACAAG GTTATCGAAC TGGATGAAGA AAGTGATGGA GGTGAAATCC  AATCCGCTCT AAAGGAGTGG ACCGGTCAGA GTACTGTTCC TAATGTGTTT ATAGGTGGGA AGCATATTGG TGGCTCGGAT GCTGTTATGG AGAAGCATCG AGCTGGGAAG CTGGTGCCGT  TGCTAACTGA AGCAGGTGCC ATTGCGAATA CCTCTGCACA GCTCTGAAGA TTGGTGTCAT GAATAAGATT ATTAAGTTGG TTTAGGAAGA AAAAACAGCG ACTGTCTGTT CTCATTGTGA  TTGTGATGTT TTTAATCATA TGATATGTTA ATAAAATACA ATCTTTAATC ATATGTGATC TGCTGTAACA TCAGAAGTTG TGTTTGTTTA ATTAGGAGTC ATTTTCACCT ACTAAACTTC  TTACTATTTG TTTATTCACG AGTCACTTTC ACTGAACAGA TTTACAAGTA ATTGCAACAG ATTCACATTT AATCTGTTGA AAAAGATGCA ATAGAATCAT GAGATCAGAA GTCTAGTTTT 
AGGTATTTAT 

Retrieve as FASTA