Entry information : HaGrxC25HanXRQChr15g0487661
Entry ID 14429
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxC25HanXRQChr15g0487661
Name HaGrxC25HanXRQChr15g0487661
Class CGYC Grx    [Orthogroup: GrxC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxC25
start..stop
S start..stop
HaGrxC12 168 2.8e-56 1..107 1..107
ThasGrxC02 159 8.87e-53 1..103 1..103
HaGrxC23 157 2.41e-51 1..107 19..125
AtGrxC01 149 2.89e-48 5..107 21..123
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14429' 'complement(join(102008659..102008738,102008839..102008937,102010202..102010290,102010471..102010526))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 102010471..102010526 54 N° 2 102010202..102010290 87 N° 3 102008839..102008937 97 N° 4 102008659..102008738 78
complement(join(102008659..102008738,102008839..102008937,102010202..102010290,1 02010471..102010526))


exon

Literature and cross-references HaGrxC25HanXRQChr15g0487661
DNA ref. HanXRQ genome:   HanXRQChr15 (102010526..102008659)
Protein sequence: HaGrxC25HanXRQChr15g0487661
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   107 (297)
PWM (Da):   %s   11177.66 (31170.5)  
PI (pH):   %s   8.07 (8.40) Peptide Signal:   %s   cut: 24 range:21-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAKAKDLVSSNPVVVFSKSYCPYCVSVKKLLTELGSTFKAIEL
DQ
SDGGEMQAALHEWTGQRTVPNVFIGGKHIGGCDSTTAMHQAGKLVPALTEAKAIATKSA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCAAAGGCTAAGGATCTCGTTTCCTCCAATCCTGTTGTCGTCTTCAGGTTTCATACATAAAATTACCTCACATTTTCTGTTCTAATCGTGAATCGGATTAATAATTAGATG
TATTTTGTCATTTTTGTTTGATTTAGCGATTTTTTTTTGTGGATATAAATGATTATTTGTGTTTAGATGAATCTGTTTGTGATGTTAATGATACGGATTTTGTTTTGTTTTGACAGCACA
AATCGTATTGTCCGTACTGTGTGAGCGTTAAGAAATTGTTGACTGAACTTGGATCTACGTTCAAAGCTATCGAGCTTGATCAAGAAA
GTGAGTTTTCTCCGTTTTGTTTAGATTTACGGT
ATATGTGTATGTATATGTTGATTGGTGATTAAATTTAGCTGTTTATCTTGTTAATTATATAGAACTAATATTTGGATTTGGATTCCGATATGTTTTAAACTTTTTATAATGTAAGAAACG
AGTTTCACTGTAATTTTTTATTTCCAAATGTTACCCTAAGATGTTTTTACTAGCAAAGTCAAATCCTACGTCGTTCTGTTCGTATGAGAGATTTTTGGTACATAGGCAATGCCTGACCTC
GAATATCGTTAACGCGGTTTGGGTGTGTTAGCTGTGGATGAGAGGAGAACTCCAAATTAAGTGTGTTTGGGTGGGGATAGTGTGAATGCATATGTCTGTAGCTTTCGTCACTTATCGAGT
CTAGTTTTGTTTAGTATTGAATTGTATAGATTAGATTGTATTTCGTATGAAATGGTTGGAATTTTGATGTAAATGACCCTTTCGCACGAAAGGCACTTTCGTGCGAGAGGGCCATATAGT
CCATTTCGTACGAGTTGGCCAACTCGTCCTAACGGTTTCGTACGGATGGGGCTTGCCTATAAATAGGAGAGTTGGGTCAGTCATTTGTAACTTTTGGCATTTGCAGCGAAGCTCTGCCAA
AATCGTTTCACGGCATTGTAACTTCTTCTAATCAATAGAAACGATTGTTCAACGGTGTCTTTGTGTGTTTGTCATCTTTATACTCGGATTCCGCACGAGATATGAAGACGTATTAGCCAG
TCGGAGCATTCGGGAGCCCTAAACGGTCCTCACAGATAGTTCCAAGATGGATGGCCTCCTGGGAGGTGTCTCATGTGCTTCTCGTTGGAAAAGTGGACAGTGTTGGTTGGTACGAGGGGT
CGGATGTTACATACCCGTCCTTGTTCATTTGATGAGAGTATCTTTGCTCGTATGTTAGTATCGAAATGATTTTGACTCTGTTTCTGAGTCCTTAAACTTGATTGTATCATCTAGTGTGCT
TAGGTAAAAAAAATTCTGACTGCCCTGTTCCCAAGCCTTTTAAATTTGATCATACGATCTATATATGCTTAGGTAAACTGAGCCTAATTCTTTAAGACCCTTAACAAACTTCCATGAATC
ATTGGAACCGGCATAATGTTTTGCCTTAGATGTGATTTTTATCCATTTGTATGGTCATGCCAATTGATTTGAAACATTCTTATACTTTACTTGACGGGTATTTCACCTGAAAAAAGTAAA
AACCTTACTGTATCTATGATTATGTCTAAAGGTGTGATGGAGGTGAGATGCAAGCCGCATTACACGAGTGGACTGGGCAACGAACTGTGCCAAACGTGTTTATTGGTGGCAAGCACATTG
GTGGTTGTGACA
GTAAGGGCTTTTAGTCTTCATGCTTTTCTTGTTTAACCCATTTTAGTTTTTTGTATGAACAACATAATGTAATGATGATCCACAACAATTTTGTATGTAGGTGTACCA
CTGCGATGCACCAAGCAGGGAAGCTGGTTCCTGCGCTGACGGAAGCTAAAGCAATTGCTACCAAATCTGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCAAAGGCTAAGGATCTCGTTTCCTCCAATCCTGTTGTCGTCTTCAGCAAATCGTATTGTCCGTACTGTGTGAGCGTTAAGAAATTGTTGACTGAACTTGGATCTACGTTC
AAAGCTATCGAGCTTGATCAAGAAA
GTGATGGAGGTGAGATGCAAGCCGCATTACACGAGTGGACTGGGCAACGAACTGTGCCAAACGTGTTTATTGGTGGCAAGCACATTGGTGGTTGT
GACA
GTACCACTGCGATGCACCAAGCAGGGAAGCTGGTTCCTGCGCTGACGGAAGCTAAAGCAATTGCTACCAAATCTGCCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTGAG AGAGTTATGG GTGTGCTTTT GACACGTATA CGCCAGCCCC CCATCATAAA ACGATTTCCA ATAATCCAAA CGTAACCGTT TTCATTGTCT TGTTCATAAC GTTGTGATCT  TTTAGGGTCC GTAAAAGCTT CAAATCCAAA ACTCTCTCAG CAATGGCTTC TGCAAAGGCT AAGGATCTCG TTTCCTCCAA TCCTGTTGTC GTCTTCAGCA AATCGTATTG TCCGTACTGT  GTGAGCGTTA AGAAATTGTT GACTGAACTT GGATCTACGT TCAAAGCTAT CGAGCTTGAT CAAGAAAGTG ATGGAGGTGA GATGCAAGCC GCATTACACG AGTGGACTGG GCAACGAACT  GTGCCAAACG TGTTTATTGG TGGCAAGCAC ATTGGTGGTT GTGACAGTAC CACTGCGATG CACCAAGCAG GGAAGCTGGT TCCTGCGCTG ACGGAAGCTA AAGCAATTGC TACCAAATCT  GCCTAAGCAA CTATTCTCGT GCTATCTAAA TAAACGGTTA TGGGTTTAAG TAATGGGTAG CAAATGTTGG ATTCAAATGT TTAGTATTGG TTTCAGGATA TGTGTTTGTT ATCTTGTGAT  ATAAGTCACT TGACCAAATA TTATCATCTG ATGACATAGA AAATCTGAAT CTCTATGGAG ATCTAAAATT ATTTTTGCTT CAGTAATGAG GTGGCATAGT ATTGGATGGT GGTGTGGGTA 
CAGTATAGGG TTGGTCTTAC ATTTTAGACA ATGATATAAC GGTCTAGTGT CTTAAGTCG 

Retrieve as FASTA