Entry information : HaGrxS02 (HanXRQChr10g0304481)
Entry ID 14433
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxS02 (HanXRQChr10g0304481)
Name (synonym) HaGrxS02 (HanXRQChr10g0304481)
Class CGFS Grx    [Orthogroup: GrxS002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxS02
start..stop
S start..stop
HaGrxS05 303 4.93e-108 1..156 1..158
ThasGrxS14-2 223 5.47e-76 16..151 25..160
ThasGrxS14-1 220 6.09e-75 16..151 25..160
AtGrxS14 208 2.7e-70 3..151 16..162
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14433' 'join(186943170..186943214,186943349..186943483,186943565..186943664,186944616..186944682,186945333..186945411,186945492..186945536)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 186943170..186943214 43 N° 2 186943349..186943483 133 N° 3 186943565..186943664 98 N° 4 186944616..186944682 65
N° 5 186945333..186945411 77 N° 6 186945492..186945536 43  
join(186943170..186943214,186943349..186943483,186943565..186943664,186944616..1 86944682,186945333..186945411,186945492..186945536)


exon

Literature and cross-references HaGrxS02 (HanXRQChr10g0304481)
DNA ref. HanXRQ genome:   HanXRQChr10 (186943170..186945536)
Protein sequence: HaGrxS02 (HanXRQChr10g0304481)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   156 (298)
PWM (Da):   %s   17689.84 (31670.9)  
PI (pH):   %s   6.52 (8.57) Peptide Signal:   %s   cut: 25 range:25-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLFNGFRSMEYTTASASRSFLRHGMRFSTSVPNDPDTHDDFKPTN
KLENSEITLKDIVEQ
DVKDNLVMIYMKGDPEQPRCGFSSLAVRVLSEYRVPIHSRNILEDPELKNAVKAFSMWPTFPQIFINGEFIGGSDIILNMHNGELKEKLKARSSE*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTATTTAACGGATTCAGGTCAATGGAGTATACAACTGCATCGCGGTATGATGTAATTAATCATTTTACTATAAAGATTTCCCCATTAAATCTGACTTTGAATAAATGTTTCATTGTA
TCTAGATCGTTTTTGTTAGTTTTTAGATTTTGTTACATGAATTTTGTGCTTCAATTTGCAGGCATCTAGATCGTTCTTGCGACATGGTATGCGATTTTCGACTAGTGTGCCGAATGATCC
TGATACACATGATGATTTCAAGCCCACAAATAAGCTTGAGAATTCTGAAATCACTCTGAAGGACATTGTTGAGCAG
AGGTTGTTGGCTGTTGATGAGTGTATATTGTTTCATGAACGTTT
TTGTACTCGTGTTTTAAAATTTTAATTTGTTATGTGTAGGATGTTAAAGACAACCTTGTGATGATTTACATGAAAGGCGATCCAGAACAACCGCGCTGTGGGTTCAGTTCGTTAGCAGTC
AGAGTATTGAGTGAATATA
TAGTAAGCTCTCAAATCATAAAATTGTTCTTTTCCTGAGATATTTTGACACACAGTTAATATTTTAACCTGAATGGTATTTGTTGAATGTATATGCACTTG
CAACTAGGGGTGTTTAGAAACCGTTAAACCGACCGAACCACCTAAATCCTAGCAAGTCGCTGGTTTGAGATCCAAATGGTTCAGTTTTTGCGGTCTAATCTTATATTTTTTATATAAATA
GTTTAGTTTTTTTTAATTTAAATGAGGCAAATGTAACATATATGTGTATTTTTATTACTATTTTGTAAAAAATAACTTACAAATTAATTTGATATAGGAGTTAATAATGAAAAGAAAATT
CACCAAATAATAACCAAGCTCCATAATTCAATTTAAGTCAAATTGGAAGAAAAAAATAACTAAATGGTAAACGAGATTCACATATGTTTTATTTGCTACACTTAGTTTTTTTTTTTAAGT
AAACATTTATAAAGTTATTATATAAGACTGGAACATGCTATGAAAGTTGGATAACTTTAGAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAACCTTTTTGAGTGACT
TTAGTGAGACACTTGGGAACCAACCCACCCAACCCAGCTGGTTTGGTTTGTTGTTTCCCGAAACTATAGTTAGTGGTTCGGCCAAATATTTTCGTCAAAAGTCAAAACCAGCCAAATCAC
CCCTAGTGGCTTATATAAACCGTTACATCCACAACGTATTTAAATAGTTGGTCATACGTTTGTTGTTTAGTTATCATGAAAAGGTAACAATCAATGCACCTTCTAGACGCGATGTATGCG
AAGATGGTATAAGCTATAAGCAGGCTAATTGCCAAAATTCGTTACATTTTAGCATATGATCTAATTCTACATTTCTACTATATTTTCAAATTGGATCAAGCGTATTTAATCATTTTGTGC
GTTGCTGCACAGGAGTCCCTATACATTCCAGAAACATATTGGAAGATCCAGAGCTTAAGAATGCCGTAAAAGCTTTCAGAGGTATCATTGTATCAAGCACCTCCTATATGCAAATTAGTT
TGCTTAACTGAACATAAAGCAGTTTCACTTTATCTTCTCCACCCTTTTAGTTATAAAATATATAAGAGTAAATTACGTTTTTGGCCCCTGTGGTTATATCTCTTTTACTATATTAGCCCA
AAATAAGAATTTTTAACATATCTGCCCCCATGGTCTCTATAACTAACCATTTTGGCCCCTAAGTCTAACCATTTTGGCCCCCATGGTCTCTATAACTAACCATTTTGGCCCTCATGATCT
CTAGACTTAGGGGCTAAAATGGTTAGTTATAGAGACCATGGGGGCAGATATGTTAAAAATTCTTATTTTGGGCTAATATAGTAAAAGTGATATAACCATAGGGGCTAAAAACGTAATTTA
CTCAATATATAATTTATATGTTGTATGATTGCAAATTCTATATCACTACATATATAATAATAATCTATATTATTGCAAATTCTATATCTTGCCCACTTTGGGCGACTTTAGACGTGTTTT
GACCCGTTTCATTTTTTAGTTAAATTATTAGTTTAGCTTGTCTGACCTGTTTTACAGATAGTTACAACCCAAGTTGACATTTGTATATATAGGTAAACAGTATATAATTAGTTTTTACCC
TTTATGTGCAGCATGTGGCCGACATTTCCTCAAATATTCATCAACGGAGAATTCATTGGAGGATCAGACATTATTCTCAATATGCATCAGAGGTGTTTTTTGGTTTGTTTTTGGCATAGT
GTTATGTTTTAATGTTCAAAATATGGATTTTAATCTTTTTGGCGTTGTGCAGAATGGTGAACTAAAGGAGAAGCTAAAGGCGAGGTCATCAGAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTATTTAACGGATTCAGGTCAATGGAGTATACAACTGCATCGGCATCTAGATCGTTCTTGCGACATGGTATGCGATTTTCGACTAGTGTGCCGAATGATCCTGATACACATGATGAT
TTCAAGCCCACAAATAAGCTTGAGAATTCTGAAATCACTCTGAAGGACATTGTTGAGCAG
GATGTTAAAGACAACCTTGTGATGATTTACATGAAAGGCGATCCAGAACAACCGCGCTGT
GGGTTCAGTTCGTTAGCAGTCAGAGTATTGAGTGAATATA
GAGTCCCTATACATTCCAGAAACATATTGGAAGATCCAGAGCTTAAGAATGCCGTAAAAGCTTTCAGCATGTGGCCGACA
TTTCCTCAAATATTCATCAACGGAGAATTCATTGGAGGATCAGACATTATTCTCAATATGCATCAG
AATGGTGAACTAAAGGAGAAGCTAAAGGCGAGGTCATCAGAGTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACAGAAAATA AGCGCCGGAA AGGGTAAATC ATCAAAGCAG ACATTTCCCT TTGCTTCGTG GAGGCCAGGA ACATCACTAA CCTTAAACCC TTCTTACATC GTAACACGAT GGCTAGGGTG  TTATTATCAA ACATGCTATT TAACGGATTC AGGTCAATGG AGTATACAAC TGCATCGGCA TCTAGATCGT TCTTGCGACA TGGTATGCGA TTTTCGACTA GTGTGCCGAA TGATCCTGAT  ACACATGATG ATTTCAAGCC CACAAATAAG CTTGAGAATT CTGAAATCAC TCTGAAGGAC ATTGTTGAGC AGGATGTTAA AGACAACCTT GTGATGATTT ACATGAAAGG CGATCCAGAA  CAACCGCGCT GTGGGTTCAG TTCGTTAGCA GTCAGAGTAT TGAGTGAATA TAGAGTCCCT ATACATTCCA GAAACATATT GGAAGATCCA GAGCTTAAGA ATGCCGTAAA AGCTTTCAGC  ATGTGGCCGA CATTTCCTCA AATATTCATC AACGGAGAAT TCATTGGAGG ATCAGACATT ATTCTCAATA TGCATCAGAA TGGTGAACTA AAGGAGAAGC TAAAGGCGAG GTCATCAGAG  TAGACAAGTC TCGTTTGCAT CTCGTGTCGC CAAATTATAT TAGATTTGGG ACGCTTAAGT TTCGAGCCAG TATACGTTAT AAACAGTTTT TAAAGCATTC TTTTTACCGT GAGTGTTGTT  CAAATAATGT TGATGTTACA ATCTACTTTT ACTGAACAAG TTGTGGTCGT TTGCTATATA CTTCTTTACA AACTGCATGA CAAAAAAGTA GACGTAAAAA ATGGCCTTGA TTTTCGATCT 
GAAGTTACCA GATTTGATAT TTCAGGTTGC CCCTACAGGG AAACAAAGAC TCGTTTCAAA TCTTTAC 

Retrieve as FASTA