Entry information : HaGrxS05 (HanXRQChr16g0504211)
Entry ID 14436
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGrxS05 (HanXRQChr16g0504211)
Name (synonym) HaGrxS05 (HanXRQChr16g0504211)
Class CGFS Grx    [Orthogroup: GrxS002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGrxS05
start..stop
S start..stop
HaGrxS02 303 5e-108 1..158 1..156
ThasGrxS14-1 228 2e-78 2..158 9..165
ThasGrxS14-2 227 1e-77 8..158 15..165
AtGrxS14 215 7e-73 2..158 9..167
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26670431..26670481 51 N° 2 26671278..26671412 135 N° 3 26671506..26671605 100 N° 4 26673936..26674002 67
N° 5 26674113..26674191 79 N° 6 26674285..26674329 45  
join(26670431..26670481,26671278..26671412,26671506..26671605,26673936..26674002 ,26674113..26674191,26674285..26674329)


exon

Literature and cross-references HaGrxS05 (HanXRQChr16g0504211)
DNA ref. HanXRQ genome:   HanXRQChr16 (26670431..26674329)
Protein sequence: HaGrxS05 (HanXRQChr16g0504211)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   158
PWM (Da):   %s   17831.83  
PI (pH):   %s   6.35
Sequence 199
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLFKGFRSMEYSRTTASASGSFLQHGMRFSTSVPNDPDTHDDFKPTNKLENSEITLKDIVEQDVKDNHVMIYMKGDPEQPRCGFSSLAVRVLSEYRVPIHSRNILEDPELKNAVKAFSMWPTFPQIFINGEFIGGSDIILNMHQNGELKEKLNKTSSD

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCTTTTTAAGGGATTTAGGTCCATGGAGTATAGTCGTACAACTGCTTCGGTATGATTTGTTTAACTTATAACGGTTTTTTATTTGTTTATAGGTCAGAGTTAGGGTTATAAATTGTTTT
AATTTGATGTTTTCGCCATTAATTTATGCTCTCTTGAGAAGATTTGTTTTAGAACGGACCAGAAGTAGTTTTCGTTTGACATAATTGATTGCTGAAAGTGCAAGTGTAGTAGGTATATTG
TTTTCGATAGAATTGAGAGTTTTATGTCAGTTTTGGTTATGTTTTTTTGTTGTTTTCGACTCGAGTGGAGTTTTCTGAGTAGCTAGGGCTTGGAAATTGGATGTTGAATGAGTTTTGTCA
TTGTTATTTGGATTATTCAGATTGGTGATATATAGAACAATGCTCTGTATCGTAGTTTAACGGTTAAACTTTAACCTCGAGAATGGCAAAATATTGAATATTGACTTTGAAATGTTGAGT
TGGGCCACCTACCCAACGCAAGCTACGTTTTACTTGATCCCATTGGTTAGCAGTGTATTGGTGGGGTCCCTTGGGTTTACTGTTAACCTTTTATAAGTTTTATGATATGTGATTTAGAAC
TTGTAGATGGTTTGCTATACATGATTCAAGTAACTAATAATTGATAACAGGGATACTCTGTCGAAGAACAACTGTTGTTAATTTGATGTGTTGTTTTGTTTTCTGATCTGTTTGTCGTTC
TTTGGATAACTAGACGATAACAGTGGTTAAAAGGGTTAGTTTTATTAAAAAAACATTGATGCTTTGTAGAATTGTAGTACCAAATTTTGTATTATCTTACACAAGTTGTATGCTTCAATC
GATTAGGCCTCTGGATCATTCTTGCAGCATGGGATGAGATTTTCAACTAGTGTGCCCAATGATCCTGATACACATGATGATTTCAAGCCCACAAATAAGCTGGAGAATTCTGAAATTACT
CTAAAGGACATTGTTGAGCAG
GTTGATTGTTGATGAGTGTATCATATCATGAACGTCTTTGTGTTAATATTACCAACCTTGTATTTTCTTACGTCTATTAGTTGCAATGTGTAGGATGTC
AAGGATAACCATGTGATGATTTATATGAAAGGGGATCCAGAACAACCGCGCTGTGGATTCAGCTCATTAGCAGTCAGAGTATTGAGTGAATACC
GTACGTTTTCGTATTATAATTTACTT
GCTTTCTTTTTTGAAGATATTTTTAACATATAATTATATTGCTTTATATTTTTCCCGGTCGACTTAAAAAATGTTCTTTTCTGTTCTATAATCAGTGACAAGTTTGCATCGTAATTCTTA
ATCTTAATATAAGATTAGAGGTTAATGCGGGGCCTTTTACCTTGTTCTATCATTGTTAGTGCAAATTGTTATTTTTACAAAATAAAGCAAGTTGTATACACATAATCAATCAATCAATCA
TACCCAGTAAAATCCCACAAATAGCAAAGCTATTTGTAGGGTCTGGGGAGGGTGGGATGTAGGCACACCTTACCTCTACCCCTAGGGATAGAGAGGCTGCTTCCAGAGAGACCCTCGGCT
CCAAAACACCCAGGAAAGAAATGAATAGAGCATGAGGTGTGTGTGTGTGTGTATGAAGCTACCAATGTAGTATGAGTTGCGAAATAGTGCATGGTAGGACAGAACAAATATGACAACACC
AAACAGCCTATACACATAGTTACATATCTACGACCATACACTACACCTAGAAACACAACTGTACAAAACATCCTATACACATAGTTACTTATGTACGCCCATACACTACACCTAAAAACA
CAATTGTACCCTCTCCTAGAAATCCTTAACCTTAATCCTACGTCTCCACGAGCTCCTATCATGGACCATGTTCTCAGAGAGGTGCAATTTTTGCAAATCCTGCCTAATCCGCTCATCCCA
AGTAATTTTGGGTCTGCCTCTACTCCTCCTCCCCTCCACCTCGAGGGTTTCAACCACTCTAACTGGTTCTATCGTCTGCCTCCTCTTCACCTGCCCAAACCATCTCAATCTTCCCTCCTT
TATCTTATCTGATATACTAGTTACTTCTAACATTTCCCTAAAAACATCATTTCTTATCCGGTCTAACCTTGTGTGGCCACACATCCATCTTAGCATTCTCATCTCTGCTACCTCCATCTT
GCGTGCCTGTACTTCCTTAATGGCCCAACATTCAGTTCCATATAACATAGCAGGTCTAATTGCAACCCTATAAAATTTCCCTTTCAATTTCGTTGGGAACCTCCTATCGCACAATACCCC
AGTGGCAGCTCTCCACCTACACCATCCGACCTGGATGCGGTGGGCAACGTCACTATCTATCTCCCCATCCCTCTGGACAAACGATCCTAGATACTTGAACTTAGTCACCTGCGGGACCGC
TTGACTGTCAATGGTGATCTGAATGTCCTCATCGTTGTCTACTCCACTAAAGTCGCAATACAAGTACTCAGTCTTAGATCGACTAATCTTTAAACCTCTTCCCTCTAAAGCTGCTCGCCA
CTCTTCTAACCTCGCATTCAGGCTTTGTTTACTATCAGCAACTAACACGATATCATCTGCAAAAAGCAGGCACCACGGAAGAGCCCCCTGAATTAACTTTGTCAACTCATCTAGGATAAC
TGCAAATAGAAAAGGGCTCAAAGCGGACCCTTGGTGGAGTCCTACCTCCACCGGGAAAGAATCAGTATCCCCTACAGGCGCTCGGACACTAGTCTCAGTCCTAACATACATATCCCTAAT
TAAGTCTATATACTTCCCAGAAACTCCTCTACTCTCCAAACTATCCCAAATCAGTCTACGTGGCACACTGTCATAGGCCTTTTCAAGATCAATGAACACCATGTGTAGGTCCCGTTTCTT
CTCCCTATACTTCTCCATTAGTCTCCTTAGAATATGTATTGCTTCCGTAGTCGATCGCCCTGGCATAAAACCAAATTGGTTTACCGTGACTTGGGTTTCTCTTCGGATTCTCGTCTCAAT
TATTCTCTCCCATAATTTCATAGTATGCCCTAGCAACTTAATCCCTCTATAATTCCCACAACATTGGGCGTGTATACACATAATATAAATCTTAAATTGTATACGAACAATCAGTTTAAA
AAGAACAAAAACTTGAATGTGTTTATTCTTGCTTCAGTTTAGTTTGGTTGTTTTCGATTCCTTTGTCTACCTCTAGTTCGATGATGATTTATGGCGTATAAAAACCATTTCATCTGCGAC
ATACCTGAATATATCATCAAATATAGTAACAATAATTAATTAATTATCAAATAAATAGGTAACAATTACACACTATTCTATAAGAACATGTTTAAATTTTGGTCACCTTCATAACTTAAC
TCTAATATTTATGTGAATGTGAATCTGGTAGAAGCAGCTTAATTGCCAAATTTGTTGCATTTTTGCATATGATCTCTTCTTTTTTTCATTTGGATTTAGTGTATTTTAGTTATTATTCTG
ATTATTAATGTGGTTTCTTCACAGGAGTCCCTATACATTCAAGAAACATACTAGAAGATCCCGAGCTTAAGAATGCTGTAAAAGCTTTCAGGTAACAAGCACTTTACATAGAAATTTATT
TCAAAATAAGCAGTTTAGGAGGTTGCATGTAAATTACGCATTTGGTGACTCCGCTAATTTCTTTGTACGGTTTATGTGCAGCATGTGGCCTACATTTCCTCAGATATTTATAAATGGAGA
ATTTATTGGAGGATCAGACATTATTCTCAATATGCATCAG
GTTAGTTTCTGCATCTTTGGTCTCTCATTCTATGGTCATATTTAATTTTAAAATGTGAAAAACATACCGCTTAATGTTTT
TGGTTTTGTGCAGAATGGTGAACTGAAGGAGAAGCTAAATAAAACATCTTCAGATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCTTTTTAAGGGATTTAGGTCCATGGAGTATAGTCGTACAACTGCTTCGGCCTCTGGATCATTCTTGCAGCATGGGATGAGATTTTCAACTAGTGTGCCCAATGATCCTGATACACATG
ATGATTTCAAGCCCACAAATAAGCTGGAGAATTCTGAAATTACTCTAAAGGACATTGTTGAGCAG
GATGTCAAGGATAACCATGTGATGATTTATATGAAAGGGGATCCAGAACAACCGC
GCTGTGGATTCAGCTCATTAGCAGTCAGAGTATTGAGTGAATACC
GAGTCCCTATACATTCAAGAAACATACTAGAAGATCCCGAGCTTAAGAATGCTGTAAAAGCTTTCAGCATGTGGC
CTACATTTCCTCAGATATTTATAAATGGAGAATTTATTGGAGGATCAGACATTATTCTCAATATGCATCAG
AATGGTGAACTGAAGGAGAAGCTAAATAAAACATCTTCAGATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCATTCTAGA GTTCCATAAC CTACATAAAA GGTCCTTGAG CTATCATTCT TTTTCACGTT TACACTCAAA AAGCAAAATA TAAAACCCCC CAGGGCAGTG TTGAGGACGA AAACAATCAT  CAAACAACCA TTAATCCTTC TTCCACCGAG TTATCTTTCT AATACGATGG CTAGGGTTTT ATCGAACATG CTTTTTAAGG GATTTAGGTC CATGGAGTAT AGTCGTACAA CTGCTTCGGC  CTCTGGATCA TTCTTGCAGC ATGGGATGAG ATTTTCAACT AGTGTGCCCA ATGATCCTGA TACACATGAT GATTTCAAGC CCACAAATAA GCTGGAGAAT TCTGAAATTA CTCTAAAGGA  CATTGTTGAG CAGGATGTCA AGGATAACCA TGTGATGATT TATATGAAAG GGGATCCAGA ACAACCGCGC TGTGGATTCA GCTCATTAGC AGTCAGAGTA TTGAGTGAAT ACCGAGTCCC  TATACATTCA AGAAACATAC TAGAAGATCC CGAGCTTAAG AATGCTGTAA AAGCTTTCAG CATGTGGCCT ACATTTCCTC AGATATTTAT AAATGGAGAA TTTATTGGAG GATCAGACAT  TATTCTCAAT ATGCATCAGA ATGGTGAACT GAAGGAGAAG CTAAATAAAA CATCTTCAGA TTAAGACAGG ATTCTTGCTG CTAAATGATA TTTGATTTAT TATGTGATTT TAAAGCGCGG  TTCTTATTAC TACCGAGTGT TGAAATAAAT GTTACTGTTG ACAGTTTAGA CTATGCGGCA TGGAGACTTG TTTACTTTTC TTGATTCTCC TTGGCAGTTT TCATGTCTCT TATATGTTGC  TTAGAAATGA CGACTACTGC AAAAACGATG CTCGTCTTTT TTAAAAGCTA TTGTTGTACC TGTATGGGCT GTATTTGGTA GGGATTGTCG CAATTGTGGT GCGTGGTGGG CTGAATTGAT  CAACCTAAAC ACGGCCTATG CATATTTGTA TCAAAAACAT CAACCCGACC CACTTGAAAT GGTGTACCTA AACACAAACT GTGTTGTAGT ATGCTTATCT ATGAGTTGTA AACAAGTTGA  AATGAATGTT AAAAAAAGGG TAGGTGGGTT GATCTTATAA AATATGTATT TTTTATTCTA ATTTTAAATG GGTTAACGGT TAACCTGTCT AATTAAAAGG AGTGAACATG TTAACCTGGA  TATAATCTGT TTGGTTAAAT GGATTATACA AGTCACCCGA ACAATGCATA TTAGACGTGA AAGACTAAAA CGTGTTTAAT TAAACCGGTT ACCAACTCTA TTATTTTTGT TAACAAGAAT 
TAGTAGTGGC TTTGCCCTCT TAT 

Retrieve as FASTA