Entry information : HaCPF04 (HanXRQChr14g0455291)
Entry ID 14477
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaCPF04 (HanXRQChr14g0455291)
Name (synonym) HaCPF04 (HanXRQChr14g0455291)
Class CPF Grx    [Orthogroup: CPF001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaCPF04
start..stop
S start..stop
HaCPF02 453 1.2e-161 1..328 1..333
ThasCPF05 393 4.64e-138 63..327 57..320
AtCPF05 383 3.95e-134 63..327 54..314
MpCPF03 363 5.77e-126 85..326 87..326
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14477' 'join(156601383..156601722,156602034..156602168,156602326..156602413,156602836..156602930,156603351..156603518,156603590..156603750)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 156601383..156601722 338 N° 2 156602034..156602168 133 N° 3 156602326..156602413 86 N° 4 156602836..156602930 93
N° 5 156603351..156603518 166 N° 6 156603590..156603750 159  
join(156601383..156601722,156602034..156602168,156602326..156602413,156602836..1 56602930,156603351..156603518,156603590..156603750)


exon

Literature and cross-references HaCPF04 (HanXRQChr14g0455291)
DNA ref. HanXRQ genome:   HanXRQChr14 (156601383..156603750)
Protein sequence: HaCPF04 (HanXRQChr14g0455291)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328
PWM (Da):   %s   36508.59  
PI (pH):   %s   9.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRRASILTYSSALSRALLSPTKQHNSLFQATSAYVAGSSRRCFSTFRFPRGYSGATRFSLSLGGLAAATVAVGCSSLLVEDEAYAKAHVKADLVPKDVVLYQYEACPFCNKVKAFLDYYD
VPYKVVEVNPFSKKEIKWSEYKKVPILTVDGEPLVDSS
AIIDQMGNKIISSKASLVVSNGDEENKWRRWVDDHLVHMLSPNIYRNTSEALESFDYIANGNFSTYEKYSVKYAGAAAMYFV
SKKLKKKYNITDERAALYDAAETWVDALDGRDFL
GGSKPNLADLAVFGVLRPIRQLKSGKDMVEHTRIGEWYSRMESAVGESSRIKA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGAGAGCTTCTATCCTCACTTATTCCTCTGCTCTATCCAGAGCCCTATTATCACCTACTAAACAACACAACAGCCTCTTCCAGGCCACCTCCGCTTACGTCGCCGGTTCTTCTCGG
CGGTGTTTTTCAACATTCAGATTTCCACGTGGCTACTCCGGTGCTACTAGGTTTTCTCTGTCGTTAGGTGGTCTTGCTGCCGCTACGGTCGCTGTTGGTTGCTCCTCACTGTTGGTGGAA
GACGAGGCGTATGCTAAAGCACATGTGAAGGCCGATTTAGTCCCTAAGGATGTTGTGCTTTATCAGTACGAAGCTTGCCCTTTCTGTAACAAGGTTAAAG
AGGTAAATTTTTCATATTGT
ATTTGAGTTAGTTTATTGTAGCGAATTGGTGTCTAATTTGTTATCTGGACGTTACGAATTGAAGCAGTGTTGTGTTTGTATTGAATAACTGAATAATGATAATGATAAGCATTCATAGAT
GTTGATAAAATGGTAACTAATGGACAAAGTTAAAGGTAAATGATAAATCAAATAATAATAACTGTGGTAGATAGTGGTTTATGATATTTATTGTTCTCTGGCAACTGTCAAGTTGGTTTC
AAATATGGCTAGGATGCACTAAATTTAGTTGGTTTTTTGTGTTGCTTTCTCAGCATTTTTGGACTACTATGATGTACCATACAAAGTTGTGGAGGTGAACCCGTTTAGTAAGAAGGAAAT
CAAATGGTCTGAGTATAAGAAGGTGCCTATATTGACGGTGGATGGTGAGCCACTGGTTGATTCGTCAG
AGGTATTTTCTTCGTATTATTCAAATTGAAATTCGGTTCTATTTTACTATGT
GAAGTACGATAAGTTGGGTTGATAATTGTCATCAACAATCAACCAGATGACACATTTAGTCAGTTGATTGATATATCCTTTGAAGACACAGTGAGTCTTTCTTGCAGCTATTATTGATCA
GATGGGGAACAAGATCATTTCGTCGAAAGCTTCATTGGTGGTCTCTAATGGCGACGAAGAAAACAAGTGGCGCAG
AGGTTTTTATTTTTATTCTCTATCTAGTGTCTAAGCAATATATTT
GTTTCTAGTTACAATGATCTAAATTTTTTAAAAGGTATCCAATAAAGATAATTACTACGTAGTTAGCAGTGGCGGACATATAGTGTTAATAGGGGTAGCACGGTCTACCCCTCAACCCCG
TCTTCGTAGTGTAAAAATACCCCTTAACTCCATTTCCGTAGTGTATAAATACCCCTCAACTCTGTTTCTGTTATATAAAGGACACCCCTGATCCTAAAAAAAAATTAGGATACCCCTAAC
TTTTTGGGCTAGTTCCGCCACTGTTAGTTAGGGTGTCTCGTTATTGATGTTTGAAGCATTTAATAGAAAAATATTAAGTAGTTATTTTATTTAGAGCTGTGAGGTGTCTATGGTGCTAAA
GCTTAGTGAAATCATGTAGGTGGGTTGATGATCATTTGGTGCATATGCTATCACCAAACATCTACCGGAACACTTCTGAGGCTTTGGAGTCCTTTGACTATATCGCTAACAATGTGGTAA
GCTATATAATAATCATTAATGTGTCATCTATTTATTTATTCAATGTGATAATGATCATAATAGGGCCGGCTCTGGGCCTGGCAAACCCGTGCCGACACCCGAGGCCCAAAATTTCAAAGG
GCTCGCAAAGTCTTTATAAGCTTGTATATGTTTATTAAATTATATATTTAGTATATTCATCCATTTATTATGCAAAAAAATATTGGTGTTGTAGTGGCAAAAACTATCTCAAAATAATGT
AAAGGTCTCAAGTTCGAGTCTTTGCTCCATCACTAAGTTTTTATTTTTGTAATTCATTTACCCTTAACCATAATTTTGGGCACAATTCTTTTCGTCGCCCGAGGCCTAAATTTTTTCAAG
AGTTTTCGGGGACGGCTCTGGATCATAAATGTGATGTTCTGCTTTTGTACTTTTAGGTAATTTCAGCACCTATGAGAAGTATTCAGTGAAGTATGCTGGGGCTGCTGCTATGTATTTTGT
GTCGAAGAAACTAAAGAAAAAGTATAACATCACCGACGAAAGAGCAGCCTTGTACGATGCTGCAGAAACATGGGTTGATGCACTTGATGGCAGAGACTTTCTAG
AGGTCGGTTTTCTTAT
TGCTTGTTTTGATTTTTAACATTGGAGTTAACGTTTTGCTTATTATTGATTTATCAGGGGGTTCGAAGCCTAATTTGGCAGATCTAGCTGTTTTTGGGGTGTTGAGACCTATTCGACAGT
TAAAGTCAGGTAAAGATATGGTGGAGCACACCAGAATTGGTGAGTGGTACTCCAGAATGGAGTCTGCAGTTGGAGAATCTTCAAGAATAAAGGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGAGAGCTTCTATCCTCACTTATTCCTCTGCTCTATCCAGAGCCCTATTATCACCTACTAAACAACACAACAGCCTCTTCCAGGCCACCTCCGCTTACGTCGCCGGTTCTTCTCGG
CGGTGTTTTTCAACATTCAGATTTCCACGTGGCTACTCCGGTGCTACTAGGTTTTCTCTGTCGTTAGGTGGTCTTGCTGCCGCTACGGTCGCTGTTGGTTGCTCCTCACTGTTGGTGGAA
GACGAGGCGTATGCTAAAGCACATGTGAAGGCCGATTTAGTCCCTAAGGATGTTGTGCTTTATCAGTACGAAGCTTGCCCTTTCTGTAACAAGGTTAAAG
CATTTTTGGACTACTATGAT
GTACCATACAAAGTTGTGGAGGTGAACCCGTTTAGTAAGAAGGAAATCAAATGGTCTGAGTATAAGAAGGTGCCTATATTGACGGTGGATGGTGAGCCACTGGTTGATTCGTCAG
CTATT
ATTGATCAGATGGGGAACAAGATCATTTCGTCGAAAGCTTCATTGGTGGTCTCTAATGGCGACGAAGAAAACAAGTGGCGCAG
GTGGGTTGATGATCATTTGGTGCATATGCTATCACCA
AACATCTACCGGAACACTTCTGAGGCTTTGGAGTCCTTTGACTATATCGCTAACAATG
GTAATTTCAGCACCTATGAGAAGTATTCAGTGAAGTATGCTGGGGCTGCTGCTATGTATTTT
GTGTCGAAGAAACTAAAGAAAAAGTATAACATCACCGACGAAAGAGCAGCCTTGTACGATGCTGCAGAAACATGGGTTGATGCACTTGATGGCAGAGACTTTCTAG
GGGGTTCGAAGCCT
AATTTGGCAGATCTAGCTGTTTTTGGGGTGTTGAGACCTATTCGACAGTTAAAGTCAGGTAAAGATATGGTGGAGCACACCAGAATTGGTGAGTGGTACTCCAGAATGGAGTCTGCAGTT
GGAGAATCTTCAAGAATAAAGGCATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCGAAAGATA ACCCCGTGAC ACTAAGTTAC AAAAGGTGAA AGTTTAAGGG ATACAAGTGT AACATTCCGT AATGATCACC GGACGTTCAT ACCGGAACAG ATCTAAAACC CTATACACGA  CGCTTCACCC TCCACTCTCC ACCGTCGCGT AACCCTAACG CAACCCATTA ACCTGCAACA ATGAGGAGAG CTTCTATCCT CACTTATTCC TCTGCTCTAT CCAGAGCCCT ATTATCACCT  ACTAAACAAC ACAACAGCCT CTTCCAGGCC ACCTCCGCTT ACGTCGCCGG TTCTTCTCGG CGGTGTTTTT CAACATTCAG ATTTCCACGT GGCTACTCCG GTGCTACTAG GTTTTCTCTG  TCGTTAGGTG GTCTTGCTGC CGCTACGGTC GCTGTTGGTT GCTCCTCACT GTTGGTGGAA GACGAGGCGT ATGCTAAAGC ACATGTGAAG GCCGATTTAG TCCCTAAGGA TGTTGTGCTT  TATCAGTACG AAGCTTGCCC TTTCTGTAAC AAGGTTAAAG CATTTTTGGA CTACTATGAT GTACCATACA AAGTTGTGGA GGTGAACCCG TTTAGTAAGA AGGAAATCAA ATGGTCTGAG  TATAAGAAGG TGCCTATATT GACGGTGGAT GGTGAGCCAC TGGTTGATTC GTCAGCTATT ATTGATCAGA TGGGGAACAA GATCATTTCG TCGAAAGCTT CATTGGTGGT CTCTAATGGC  GACGAAGAAA ACAAGTGGCG CAGGTGGGTT GATGATCATT TGGTGCATAT GCTATCACCA AACATCTACC GGAACACTTC TGAGGCTTTG GAGTCCTTTG ACTATATCGC TAACAATGGT  AATTTCAGCA CCTATGAGAA GTATTCAGTG AAGTATGCTG GGGCTGCTGC TATGTATTTT GTGTCGAAGA AACTAAAGAA AAAGTATAAC ATCACCGACG AAAGAGCAGC CTTGTACGAT  GCTGCAGAAA CATGGGTTGA TGCACTTGAT GGCAGAGACT TTCTAGGGGG TTCGAAGCCT AATTTGGCAG ATCTAGCTGT TTTTGGGGTG TTGAGACCTA TTCGACAGTT AAAGTCAGGT  AAAGATATGG TGGAGCACAC CAGAATTGGT GAGTGGTACT CCAGAATGGA GTCTGCAGTT GGAGAATCTT CAAGAATAAA GGCATAAATT TCTTGTTGCG TAGAAGTCAA ACGTCAAACC  TAAAGATAGA CCATTGATAA CACACATGCA GACATACAAT AACATAGATC ATTTTGTTTG ATCTGCACCG GGGATGGATG CTTACCTGGT GTCGGTCACC TCACTTTCTT GGATGGGATA  CGAATTCCGG ATTTCAACTT TTATCATTTA TGGAATGGAT TCACCACACC TCATGTATAA GGGAAAACCG ATATTAGTTT TGTTTGTTTT TTATTTGTTG GAGTCTACTT TTTTAAAATC 
AATTAGTCAC CGATTTATTT ATTAAAAATT T 

Retrieve as FASTA