Entry information : HaLilium04HanXRQChr12g0354801
Entry ID 14486
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaLilium04HanXRQChr12g0354801
Name HaLilium04HanXRQChr12g0354801
Class Thioredoxin Type Lilium    [Orthogroup: Lilium001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaLilium04
start..stop
S start..stop
ThasLilium02-2 284 3.74e-98 55..212 73..230
ThasLilium02-1 272 1.81e-92 60..215 142..297
ThasLilium05 251 3.75e-85 54..217 67..235
AtLilium05 240 5.98e-81 55..191 66..202
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14486' 'complement(join(1637221..1637352,1638239..1638403,1639981..1640163,1642359..1642544))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1642359..1642544 184 N° 2 1639981..1640163 181 N° 3 1638239..1638403 163 N° 4 1637221..1637352 130
complement(join(1637221..1637352,1638239..1638403,1639981..1640163,1642359..1642 544))


exon

Literature and cross-references HaLilium04HanXRQChr12g0354801
DNA ref. HanXRQ genome:   HanXRQChr12 (1642544..1637221)
Protein sequence: HaLilium04HanXRQChr12g0354801
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221
PWM (Da):   %s   24517.35  
PI (pH):   %s   8.65
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAIVRLSSLSTSFNCVQQTQFVCKNNSKKLLSVASGSCSSSHFIVSSLFGVNHKKQSLQFKIQATITETEQPKWWEKNAGPNMIDIHSTHEFLHALSEAGDKLVIVEFYGTWCASCRAL
FPK
LCRTAQEHPEILFLKVNFDENKPMCKNLNVKVLPYFHFYRGADGQLESFSCSLAKFQKIKDAIQKHNTDRCSIGPNIGVGDVNLETVSAPKNKAAESP*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTATTGTTCGATTGTCATCGTTATCAACATCATTCAATTGCGTTCAACAAACTCAATTTGTATGTAAAAACAACAGCAAGAAGCTTCTATCAGTTGCTTCTGGTTCCTGTTCT
TCTTCTCATTTTATCGTCAGTTCTTTATTTGGCGTAAATCACAAGAAGCAATCGTTACAGTTCAAG
GTAATTTAAAAGAAATTTCGTGTTTGTGTTAAAATACAAAAAATTGACTGAATT
AGGGTTTTAGGTTTGAAGTTATTTGTCAAATTGGATGTTGCTTATTGTTTAATTTGTGTTATGATTGAGAAATTAGGTTGTGTTTGGTTTGATTTTGGTTAATATGTTGATGAATTGTTT
GTTTACTTAATTGATATTAGGGTTACTGTTGGATTTAGGTTAAACAATGTACCTTATTTGAACTGTGATTTGTAGGATGGATACCTATTACAGTTTACAATTTCTTTGTAATTTGTAATA
ATTATTGTGAAATTAGCATAACTAGTTACTAGTGTTCTTCATCCAAACACTGGAAAGTGGTTATCTGCTTATAGAAAATGCAATAAGACCATGTGTTACTGTTTCACATATTTTCACTGC
CACGCTTGGTTTTAAATTGCGCGATGCGCTCCTATGCGTTTGGTCCGCAAATCTGACGTGTGATACGAGTGCATTATGTTAGATGTATGCGACACACTCTTTATAAAAAAAGTACTAAAA
TTTTATTTTTTTTTATTAATAACAACCTTGGTTTTAAATTGCGTGATGCGCTCCGATGCGTTTAGTCCAAAAATCTGATGCGTGATGCGTGATGCGCGATGCGAGCGCATCACGTATGTG
ATGCGTTCTTTATAAAAAAAATAGTTAAAAATTATTTATACATAAAAACTTATAAAAACATACTTAAAGTAAGACAACTGACGTAATTAGAAGATAAGAGTTGTGTTTTTTGGTTCAAAT
CAAGCATACTAAGATGTTAATTATGGAAAAAACCGAACACAGTTCATAAAATCTGGAAAAAAAGCATAAGAAACAATGTTGCGTGCATCAGAGCGCATTGTGCGATGAGCGCATTATGCG
AAATGCACGCAATATTCTCGCATCACGTAAACGCATCGCATCAGCTGTTGCGATGCGCTCTCATTAGTGCATCGGGCGCATCACGCATTATGCGCACATTTTAAAACCAAGATAACAACT
TATAAAAACATGCTTAAACTAAAAAATTCACGTAATAAGAAGATTAGAGGTGTGCTTTTTGGTTCTAATCAAGCATGCTAAAATATTTCTAGAACCACGAAAAAGTGTTTAGGAACCATA
ATGGTCGAAATCAAGCATACTAAGATATCAATTATTGAAAAAAAACAAAGAATTTTGCGTGCATCAGCGCAATATCCTAGCATCACGTAAAAGCAACGCAACAGCTGTGGTGATGCGCTC
TCATCGTCAGTGCGACGGGCACATCAACCATCCTATGTGCATTTTAAAATCAAGATGTCACATCACTGCCATGTAGACATGTAGTCATGAGCTCTCACTCACTTTTTTTCACCTGTGTAA
TGGTTTCACAAGTTTCACTATCCCCGCCACCCATTAAAATGATATTTATATTAAATATATTAAAAAATAAAAAGAAAGGGTGGATTTAATCGTTTTATTGGTTGAGAGCCTTGGGGCCCA
CCAAACCCTTCTCCTTCACCAGCGTGAACTGCCTCACGCCTCCTCCTCTTTCACCTAATGCCCCAAGGGGCGGTGTTTACGCCGGATCTCCACCACCGTGGCAAGGGCATGATCCGATAA
CACATAGCCTAAACCGATAAACTGTTTGAATATGCAATCCCAAACACCCAGTTTAATAGGAAAATAAGAAAAGATCAATGATAGGTATGTACTACCATTGCAACAGAAGGAAAGAAAGTT
AATATGCACTATTATTACAGTGTAAAGTTTTTAGCTTTTACAGTTTAAAAGGATGAATACATGCATACCTTGAATTGTTTTTATAATCTAAAAAAACAGAAAAAATAATTTTGTTATTTA
ATGCATGCCCGTATTCATTTTGGTACTGGTAAAACATACCCTGTATTCGATTTCGGATTCCTTGACAAACATTGATTTTTTTTGTAGTTCTTTGTGAATATAGCATTTCATACGTCGATT
TGGTTCCTGCAATTCTTTTTTCGTATGATTCCTGTCATTAAGTATTTTTGTCCTTATCTTTTATATGTCAATGAAATGATGGTTTCGTTATATGATTAATTATATATCCTTCTAGAAGTC
CAAGACTTCATATACATGTGTGTGTGAAACCGAACAATGTGAGTGAGAATTTATGCGTATTCCCTCGTTTTAATTGTATGCATATCTGATGCTTCTTTCAGATATTCAAGCAACAATTAC
CGAAACCGAACAACCAAAATGGTGGGAGAAAAACGCCGGACCAAATATGATTGACATACATTCGACACATGAATTTTTACATGCCTTAAGTGAGGCTGGAGATAAATTAGTGATCGTTGA
ATTTTACGGGACATGGTGTGCTTCTTGTCGTGCTTTATTCCCAAAG
GTAGTTTGTTATTCAGTTAACGTTATTTTAATCTCAATATTAGTTTTTTGATAATCTCACATTTAAATTATTCA
ACTTGGCAAGCTGCACAAGATAGAAAATAGACTTTACAGTTTACACTTTTTCTCCGATTTTAGCAACCACTTTTCTTTTTTCTGATGTGGCGGCTGGCATGGCATCAACTAGTGTCACGT
CATCAGCACCTAACAGGTAAAATCAGTTAAAATGTGGTTGATTGCTAATACCGGGGAAAAATGTAAACTTGTAAAGTCAGTTTCATTTGCATGCAGTTTGCCGATTCAACTATTCAGTTT
TACAGTTTGACTTTTCAGGTCAGCATGACTAACTTGTGGCGTCAAATTTGATATGATTTTTTAAGTTTTTGAGAAATACTTGGTATATACAATAAACTTTATAGCATGTGCTACAATTTG
ATGGTGAATTTGAAGTGCTATTGATCCCAAAAGTCAAAAAATACAAATCCTTTTGAGTATACAACAATATATGGTTTTACGTAAACTAATGAAGTTGAATTAAATATAATTCTCGGTTGC
CTGATGTTGTTGAAGGATATTTTATAAATTTATAATTTTAAGAATATCGACCCCGGGGTCTCACTGGAAGCAGTCTCTCTATTCCTGCGGGGTAGAGGTAATGCTGTCTACATCTTACCC
TCCTTAGACCCTACCTTAGGTTTGCTATTGGTGGGATTTACCGAGTATGATGATGATTTATGATAATTTTAAGAATATCCTTCTCAAAGCTCAAAATAATTCTATGCCTTAGATTATAAG
AATCAAAATCAATTTATAGTCAATTATTTCCCTGCGGCCTGCATCAGCTAAGAAAGACTCTAAAATTTAAATTAATGAGTAAACTGTCATTTTCGTCCCTGAGGTTTGGCCAGTTTTGCG
ACTTTTGTCCAAAGGTTTGTTTTTCCGCATCTGGATCCAAAAGGTTTGAAATCTTACCATTTTCATCCGGTCCATTAACTCCATCCATTTTTCTCTGTTTAGTCATGGGTATTTCTGTCT
TTTTTTGAAACTTAAAGACCTAACTGCCCTTAAAGTTAACAAAAAAAGACAGAAATACCTCTGACTTAACGGAGAAAAATGGATGGAGTTAAACGAAACGAACCAAATGAAATTGACAAG
ATTTCAAACCTTTTGGATCCAGATGTGGAAAAACAAACCTTTGGGCGAAAGTCGCAAAACTGGCCAAACCTCATGGACGAAAATTGCATTTTACTCTAAATAAGTTTATAATATCATATT
TTCCCTTTCAAAACATTAGAAGTTTCATATTTACCCATCACATAGTGAAAAAAATGAAATTAGTTTCATATGACAGTCTATTTTACTGAATTATTAATGCAGAGAACATTCTGTGCTGAG
ATGACTCATTAATTACAATGTCTTTCTGTTTGTTTGTTTAGAAACTGATTGTATTTTATTTACAATGATATCCATATATATGATTTTATAGTTTAAAGGGAGTAATATTCACAGATGTTA
AATATGATCAAGCAATCATGGTTCATTTTGTTGATGTTGACTTTTTTTGGTCAACATTTTCAGCTCTTTGCCGAACGGCTCAAGAACACCCTGAAATCTTATTCCTGAAAGTCAACTTTG
ATGAAAACAAGCCGATGTGCAAGAACTTGAATGTGAAAGTCCTTCCTTATTTCCATTTTTACCGTGGAGCTGATGGTCAACTCGAATCTTTTTCTTGTTCACTTGCTAAA
GTAAGCAAAT
CTTGACCCATTAATCTTTTTATCGGAGTTTTTAAAAGGATTCACTTTGGAACATATAAGACAGTGTCGTGTAACAAATTAGAACCGCATGATATGCATGGTTGGTTTATCGGGTAGTTGT
GGCAAATTGGACAGGTCGGGTAACGGGTTAAAACGTATGGTCATTGAGTACAAGTTAAAGCGGGTCGGGTCAGGTTGACCCACAAATGCTTAGTTGTCTTTTGTTTTGAGTTTTAGAAAT
ATGTCATATTTGATACAAAAACTATCTTGCAAGAGTTAATTACGTTTTTCGTCCCTGTGGGGTTTGTTGAAAATAACCGTTACAGTCCATTAGTTTAGAAATTGCCAAAACAGTACCGGT
ATTTTCACTTTTGTAACAATTACAGTCCACCTCCATTAAACCCATCCAATTCATCGTTAAGTTTTTGGTGAAAAGACTAAAATATCCCTATAATATTGCTTTTTAGTTTTTTAACCTAGG
GGTATTTTAGTCTTTTTCACCAAAAGCTTTATGATACATTGGATGGGGTTAACGGAGGTGGACTGTGATTGTTACAAAAGTGAAAGTACTGGTACTGTTTTGACAATTTTTAAACTAATG
GACTGTAATGGTTATTTTCAACAAACCACAGGGATAAAAAACGTAATGAACTCTTCTTGCAATAACAATCAAATTTAAGTTTTCAGTTAAAATGTGAAAAATAATTAATAATGCCACATG
AGATGCCAGGCATATACAATACAAATGACAATTACAGATATCATATTTCACGCTTAAATAAAGCAGATAACGGTAAACACTCATCTAAAAACACAATAAGCATATAGTTTGTTTAAATAT
GCAATGTTCCTCAATCTACCCGTCCGATGTTTGCAGTTTTCCAGAAAATTAAGGATGCAATTCAGAAACACAACACGGATCGTTGCAGCATTGGTCCAAACATAGGTGTTGGAGATGTAA
ACCTTGAAACGGTGTCAGCCCCGAAAAACAAAGCGGCAGAATCGCCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTATTGTTCGATTGTCATCGTTATCAACATCATTCAATTGCGTTCAACAAACTCAATTTGTATGTAAAAACAACAGCAAGAAGCTTCTATCAGTTGCTTCTGGTTCCTGTTCT
TCTTCTCATTTTATCGTCAGTTCTTTATTTGGCGTAAATCACAAGAAGCAATCGTTACAGTTCAAG
ATTCAAGCAACAATTACCGAAACCGAACAACCAAAATGGTGGGAGAAAAACGCC
GGACCAAATATGATTGACATACATTCGACACATGAATTTTTACATGCCTTAAGTGAGGCTGGAGATAAATTAGTGATCGTTGAATTTTACGGGACATGGTGTGCTTCTTGTCGTGCTTTA
TTCCCAAAG
CTTTGCCGAACGGCTCAAGAACACCCTGAAATCTTATTCCTGAAAGTCAACTTTGATGAAAACAAGCCGATGTGCAAGAACTTGAATGTGAAAGTCCTTCCTTATTTCCAT
TTTTACCGTGGAGCTGATGGTCAACTCGAATCTTTTTCTTGTTCACTTGCTAAA
TTCCAGAAAATTAAGGATGCAATTCAGAAACACAACACGGATCGTTGCAGCATTGGTCCAAACATA
GGTGTTGGAGATGTAAACCTTGAAACGGTGTCAGCCCCGAAAAACAAAGCGGCAGAATCGCCATGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCGGTTAAG CCTAGTTTTG ATACAATTAT TATCGTACAT GTGGTACATT CTGGTTCACA CAAATCCCCT CACTCACATC ATTCACGAAA AAGTTTCTGC AGCCCTCTTC CAAGTCGCCT  TTCTCCCCCA AAAAACACTT CAATTCTGTT CTCATAAACC TTCGCAATTC CATCTCTGTT GAGTGTTTTA TGGCGGCTAT TGTTCGATTG TCATCGTTAT CAACATCATT CAATTGCGTT  CAACAAACTC AATTTGTATG TAAAAACAAC AGCAAGAAGC TTCTATCAGT TGCTTCTGGT TCCTGTTCTT CTTCTCATTT TATCGTCAGT TCTTTATTTG GCGTAAATCA CAAGAAGCAA  TCGTTACAGT TCAAGATTCA AGCAACAATT ACCGAAACCG AACAACCAAA ATGGTGGGAG AAAAACGCCG GACCAAATAT GATTGACATA CATTCGACAC ATGAATTTTT ACATGCCTTA  AGTGAGGCTG GAGATAAATT AGTGATCGTT GAATTTTACG GGACATGGTG TGCTTCTTGT CGTGCTTTAT TCCCAAAGCT TTGCCGAACG GCTCAAGAAC ACCCTGAAAT CTTATTCCTG  AAAGTCAACT TTGATGAAAA CAAGCCGATG TGCAAGAACT TGAATGTGAA AGTCCTTCCT TATTTCCATT TTTACCGTGG AGCTGATGGT CAACTCGAAT CTTTTTCTTG TTCACTTGCT  AAATTCCAGA AAATTAAGGA TGCAATTCAG AAACACAACA CGGATCGTTG CAGCATTGGT CCAAACATAG GTGTTGGAGA TGTAAACCTT GAAACGGTGT CAGCCCCGAA AAACAAAGCG  GCAGAATCGC CATGACATTT AGGAAAAGCC GTCGACTCCA TGCCCTTTTA TATGTTGTTT ATATTTGTTT AGTTACTAAT ATTGTAATGT TCATGAAAAG TGGTAGCCCA AATTTGAAAT  TTGGTATTTG ATATACATAT GTATTTTGGT GTGTATATAT TTCTGTTTCT ATCCCATTTA AGTGAGGTAA TGGACCAATT GCAACCTGCT CTAGTCGGCC GATTTTGAAA TGATAATATA 
CATAATGTAC GTAGTAGGCA TGTAAAGGAG TCGAGCCTGC CACGATCAAA CATGATCTAG GCGTGTTTAA CTTAACTTAA GAAAGCTGGA GTTTGATACG TTTCTACTTT C 

Retrieve as FASTA