Entry information : HaLilium05HanXRQChr13g0397771
Entry ID 14487
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaLilium05HanXRQChr13g0397771
Name HaLilium05HanXRQChr13g0397771
Class Thioredoxin Type Lilium    [Orthogroup: Lilium002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaLilium05
start..stop
S start..stop
HaLilium01 412 1e-146 1..295 1..290
ThasLilium01-2 290 8e-99 43..295 40..283
ThasLilium01-1 289 2e-98 51..239 48..236
AtLilium01 271 7e-93 99..295 1..177
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 76983409..76983642 234 N° 2 76984033..76984212 180 N° 3 76984280..76984444 165 N° 4 76984833..76985141 309
join(76983409..76983642,76984033..76984212,76984280..76984444,76984833..76985141 )


exon

Literature and cross-references HaLilium05HanXRQChr13g0397771
DNA ref. HanXRQ genome:   HanXRQChr13 (76983409..76985141)
Protein sequence: HaLilium05HanXRQChr13g0397771
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   295
PWM (Da):   %s   31970.15  
PI (pH):   %s   8.66
Sequence 336
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKIISNGYKFPACNHGFGYNKFDSFSHVMVKMPVFSTSGSNLTLRMSADADFFDRRAALGGQGRRVLTQVAAASDSKMGIIGIGKSLKWWEKGLQPNMKEITGAEDLVESLSKAGDQLVIVDFFSPGCGGCRALHPKLCQLAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFFRFYRGDEGRLCSFSCTNATIKKFKDALAKHKPDRSSVGPAKGLEEKELVALGANRDLSFAYNPQPENPQKEVAPPPLLPVPTVATGGSGSQSLPLPLPIPLKSTSESKEDNKDKTLVSSGR

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTAAGATCATAAGTAATGGTTATAAGTTTCCTGCTTGTAATCATGGTTTTGGTTACAATAAGTTTGATAGTTTTTCTCATGTTATGGTAAAGATGCCGGTTTTTTCGACTTCCGGAT
CGAATTTGACCCTTCGGATGTCGGCCGACGCCGATTTTTTCGATCGGCGTGCGGCTTTAGGTGGTCAAGGCAGAAGGGTTCTGACACAAGTAGCTGCAGCTTCTGATTCTAAG
GTCTGTT
TTTATTATTTTCATTTTTTTTATTTTCTTAATTCAATTACATTATTAAGCAATTTGTTTTGAAATTCAAATTGGGTGTCTTCAAGATTTGTTTTTTTTTTTTGGTTTGGTTTATGCATAT
GAATTAATTAAAAAATATCTTTTTTCAACAAGAAATATGAGAACTTGATGTTTTACTTTTACCCAGATATAAATTACTACAAAATAGGTAAATTATTGTTTTACCGTGTTAAGAAAACCA
GAAAAACAACAAATGTTAGGAATCAGATCTTGATTTTAAATATCTTGCAAGAAAAAGCATAAATCTTGAAATATATATAACAAGCAATCAAATTAACTATACAGATACTATGTTGTTGAT
ATCTTGAAATTGTGATTAAACAGATGGGTATTATTGGCATTGGAAAATCTTTAAAATGGTGGGAAAAAGGGCTTCAACCAAACATGAAGGAAATAACCGGTGCAGAAGATCTCGTTGAAT
CGCTGTCAAAAGCCGGCGATCAACTAGTCATTGTCGATTTCTTCTCACCTGGTTGTGGTGGCTGCAGAGCTCTTCACCCCAAG
GTATGTATGTCATTTGTCGAGCTTTCGTTAAAGACCT
TTTTTTAATCTTTTTTCTTTGATTTTGCAGTTATGTCAATTAGCAGAGATGAATCCTGATGTCCAGTTTTTGCAAGTGAACTATGAGGAGCACAAATCCATGTGTTATAGCCTCAATGTT
CATGTTCTTCCATTCTTTCGGTTTTATAGAGGGGATGAGGGTCGTCTTTGTAGCTTTAGTTGTACCAATGCTACG
GTTCGTGCCAATTTTATTATTTCTTGTTTATTTTAGTAAGGGTAA
ATTGCATTTTACGTCATTTAAGTTTCAGCAAAATTTCAGGTGCAGTTTCTTTAACTAACGAAATTACAGCGGATGTCCTTTATGTTCTAATTTCCTTACAGTAGATGTCCTTTATGTTTT
AATTTCTTTATAGCGGATGTCTTTTATTTTTGTAATATTTTTACGGAGAAAGGATTGCGCCTGTAAAAAAAAAATAGAACATAAAGGACATTCGCTGTAATTTCGTTAGTTAAAGGACAA
CGCTTGAAATTTTGCGGAAACTTAAAGGACGTAAAATGCAATTTACCCTTTTAGTAACGTTATAAACGATGATTGTTTGAACTCGAGTACAATGATGATACAGATCAAGAAGTTTAAAGA
TGCATTGGCGAAACACAAGCCCGACCGAAGCAGTGTAGGCCCAGCGAAAGGTCTCGAGGAGAAAGAGTTGGTGGCACTCGGGGCCAATCGGGACCTTTCTTTTGCGTATAATCCACAACC
GGAGAACCCGCAAAAGGAGGTTGCACCACCACCATTGCTGCCAGTGCCAACGGTGGCAACAGGGGGTTCAGGTTCACAAAGCCTGCCTCTTCCTCTTCCGATTCCCTTGAAGTCAACATC
GGAATCGAAAGAAGATAATAAAGATAAAACATTGGTGTCTTCTGGGAGATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTAAGATCATAAGTAATGGTTATAAGTTTCCTGCTTGTAATCATGGTTTTGGTTACAATAAGTTTGATAGTTTTTCTCATGTTATGGTAAAGATGCCGGTTTTTTCGACTTCCGGAT
CGAATTTGACCCTTCGGATGTCGGCCGACGCCGATTTTTTCGATCGGCGTGCGGCTTTAGGTGGTCAAGGCAGAAGGGTTCTGACACAAGTAGCTGCAGCTTCTGATTCTAAG
ATGGGTA
TTATTGGCATTGGAAAATCTTTAAAATGGTGGGAAAAAGGGCTTCAACCAAACATGAAGGAAATAACCGGTGCAGAAGATCTCGTTGAATCGCTGTCAAAAGCCGGCGATCAACTAGTCA
TTGTCGATTTCTTCTCACCTGGTTGTGGTGGCTGCAGAGCTCTTCACCCCAAG
TTATGTCAATTAGCAGAGATGAATCCTGATGTCCAGTTTTTGCAAGTGAACTATGAGGAGCACAAAT
CCATGTGTTATAGCCTCAATGTTCATGTTCTTCCATTCTTTCGGTTTTATAGAGGGGATGAGGGTCGTCTTTGTAGCTTTAGTTGTACCAATGCTACG
ATCAAGAAGTTTAAAGATGCAT
TGGCGAAACACAAGCCCGACCGAAGCAGTGTAGGCCCAGCGAAAGGTCTCGAGGAGAAAGAGTTGGTGGCACTCGGGGCCAATCGGGACCTTTCTTTTGCGTATAATCCACAACCGGAGA
ACCCGCAAAAGGAGGTTGCACCACCACCATTGCTGCCAGTGCCAACGGTGGCAACAGGGGGTTCAGGTTCACAAAGCCTGCCTCTTCCTCTTCCGATTCCCTTGAAGTCAACATCGGAAT
CGAAAGAAGATAATAAAGATAAAACATTGGTGTCTTCTGGGAGATGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCTGATTCGT GTATGACTAG GAAAAGCATA GTCCAGAAAA AAATGAAATT AATCCATAAT GAAAAAATAA TGACCCCACA ATTTCTTCAA TCTCAATTTC AAAACCACTT TAAGTCTTAC  ACGTATACAA TGAAATTGCA CAATAAGCAA TCCCAATTGC CCCTTTTATT GGCTTTGACT TGAAGCAATC CAAAAACCCT GAATTAAATC TCATTCATCT TTGATCTTAC AAAAACTAAA  AAACCCATTT TTCTTCAATC AAATTGAATT AGGGAAATAT TGTCATATTG AAATAATCAT GGCTAAGATC ATAAGTAATG GTTATAAGTT TCCTGCTTGT AATCATGGTT TTGGTTACAA  TAAGTTTGAT AGTTTTTCTC ATGTTATGGT AAAGATGCCG GTTTTTTCGA CTTCCGGATC GAATTTGACC CTTCGGATGT CGGCCGACGC CGATTTTTTC GATCGGCGTG CGGCTTTAGG  TGGTCAAGGC AGAAGGGTTC TGACACAAGT AGCTGCAGCT TCTGATTCTA AGATGGGTAT TATTGGCATT GGAAAATCTT TAAAATGGTG GGAAAAAGGG CTTCAACCAA ACATGAAGGA  AATAACCGGT GCAGAAGATC TCGTTGAATC GCTGTCAAAA GCCGGCGATC AACTAGTCAT TGTCGATTTC TTCTCACCTG GTTGTGGTGG CTGCAGAGCT CTTCACCCCA AGTTATGTCA  ATTAGCAGAG ATGAATCCTG ATGTCCAGTT TTTGCAAGTG AACTATGAGG AGCACAAATC CATGTGTTAT AGCCTCAATG TTCATGTTCT TCCATTCTTT CGGTTTTATA GAGGGGATGA  GGGTCGTCTT TGTAGCTTTA GTTGTACCAA TGCTACGATC AAGAAGTTTA AAGATGCATT GGCGAAACAC AAGCCCGACC GAAGCAGTGT AGGCCCAGCG AAAGGTCTCG AGGAGAAAGA  GTTGGTGGCA CTCGGGGCCA ATCGGGACCT TTCTTTTGCG TATAATCCAC AACCGGAGAA CCCGCAAAAG GAGGTTGCAC CACCACCATT GCTGCCAGTG CCAACGGTGG CAACAGGGGG  TTCAGGTTCA CAAAGCCTGC CTCTTCCTCT TCCGATTCCC TTGAAGTCAA CATCGGAATC GAAAGAAGAT AATAAAGATA AAACATTGGT GTCTTCTGGG AGATGAGTTT TATCATAAGT  ATTTCGTATG TTATATTTTA GTGTTTTTGT ACTATTTTTG TGGATGTGTA AATAGTACAA TGGTCTAGCC CAAGTGTGTG CACATCTGTA TGCCCATTTT ATTGTGGCAT TCAGAAGCTT 
AAATTTGAAA TTTCTGTCTA ATAAGAGGGT GATTTTGTTT TACACATTGG CTTTTTTTTT TTTTTT 

Retrieve as FASTA