Entry information : HaTrx03 (HanXRQChr09g0246861)
Entry ID 14491
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2018-03-08 (Christophe Dunand)
Peroxidase information: HaTrx03 (HanXRQChr09g0246861)
Name (synonym) HaTrx03 (HanXRQChr09g0246861)
Class Other Thioredoxin    [Orthogroup: Trx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrx03
start..stop
S start..stop
AtTrx07 189 1e-61 82..199 72..189
ThasTrx07 181 2e-58 65..198 55..187
AtTrx08 147 8e-45 81..197 91..207
PpaTrx06 145 2e-44 83..197 79..189
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 64390329..64390672 344 N° 2 64391528..64391602 75 N° 3 64391690..64391756 67 N° 4 64391875..64391892 18
N° 5 64391975..64392079 105  
join(64390329..64390672,64391528..64391602,64391690..64391756,64391875..64391892 ,64391975..64392079)


exon

Literature and cross-references HaTrx03 (HanXRQChr09g0246861)
DNA ref. HanXRQ genome:   HanXRQChr09 (64390329..64392079)
Protein sequence: HaTrx03 (HanXRQChr09g0246861)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   202
PWM (Da):   %s   22660.67  
PI (pH):   %s   8.72
Sequence 243
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRNIPLGLLPQQLRSTPAAAMTDATTLPFQTLHLPSNRLAFSNSGSSSRSLSDFWRFKYDVCTGSLKALSQQRSIPVIDSSSPVSLDLKPILNECQFDHVIHDAQRLDDSVVVLWMAKWCRKCIYLKPTLEKLAADYHPRVKFYCIDVNNVPYQLVVRAGVTKMPTIQLWKDGKKQAEVIGGHKAYLVANEVREMIDDEGQP

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCGTAACATTCCACTTGGTCTTCTTCCTCAACAACTCCGATCTACACCAGCTGCCGCCATGACCGACGCTACCACACTACCTTTTCAAACACTACATCTTCCATCCAATCGTCTTGCGT
TTTCAAATTCCGGATCTTCTTCAAGGTCCCTTTCAGATTTTTGGAGATTCAAATATGACGTATGCACAGGGAGTTTGAAGGCCTTGAGCCAGCAAAGATCGATTCCGGTTATTGATTCTT
CTTCCCCTGTTTCACTCGACCTCAAACCTATTTTAAACGAATGCCAATTTGATCACGTCATTCATGATGCTCAACGGTTGGATGACTCGGTTGTTGTTTTGTG
GTATGTTTACTGCTTTA
GATTGTTGCAAAATATGTATTTGTTATTATTATGAATATGTATATGATGATTAACATGGGTTTGTATTCTAATTTCATGCTGATACTTTATGTGTTAGGCTTTGTGTTTAGTAGAATCGG
TTTTGCTATTCAAAAGAGGCTTATTACCTAGGGCTCTAAACGAACCGAATGTTCAGCGAACAGTTCGTGAACTGTTCGGCGGGAAGTTGGTGAAAATGAACAAGAAATTCCGTTCGATTA
GTTAAATGAACGAACACGAACAACTGTCTCGTTCGTTCAATTGCGTTCATGAATGTTCGGTAACGTGTTCGTAAACATTCGTTCATGTTCGTTTGTTTATGTTCATTAAATATTTTTTTA
GCATTTATTTATTTTATCTAAATCTTTTATATTCCTTAATTCTTATTTATCTCATTACCCAAACAAATAAAATAGGAAACCCTACCTCCACCTTTCTTTCTTATTATTCACATCGAAAAA
TACAATTGAACTTCGTCGATTTTATCTGTGTTCGTGAACCGTTCATGAACATGTTCATTTCCTTAACAAACGAACACGAACAAAAAATCTCGTTCGGTAAGTGTTCATGAACTGTTCGTG
AACACATAATATTCTTAACGAACGAACACGAACAAGGCCTTGTTCGAGTTCGTTCGGTTCGTTTACAACCCTGGCTGCCTGCCACTATATTGTAATGGCCACCAGTTTCTTAATTTTCAT
CATATTATACAATTTCTATTCAGGATCTTAATCTTATTGCCACATATCAATATTTGATGGGATATGGATCATGTTTAGCCAGAATTATTAGGTGAGCTAATGTTATTTGTGTTCATAGGA
TGGCAAAGTGGTGCAGGAAATGCATATATTTGAAACCAACATTGGAAAAATTGGCAGCTGATTATCACCCAAG
GTTAAAACTTAAAACTCGCCCTTTTGCTCAACTATCGCGATGTTCAC
ATTTCTCATACTTACTTGTGTTTGGATATGTTAAAAGCAGGGTAAAGTTTTACTGCATTGATGTCAACAACGTCCCGTATCAGCTTGTGGTTCGGGCTGGGGTCACTGTAAGTCTCTCAT
GCCCGCACAATTAGTTCAGTTTATCATTTTCAGACGTTAACACTTGAATTGTGCAATTTCATGTCATTTGACTCATTTGGGATCGGATGTGCTCTATAATCACAGAAAATGCCAACTATA
CAG
GTGCACAGATTTATCTAACAATATTTTTATTATGTTTGCTAGCTGTTGCTACCTTCGAAACTAATGTGTTTTGGTATTCCAGCTATGGAAAGATGGGAAGAAACAAGCAGAGGTGAT
CGGAGGTCACAAAGCGTATTTAGTTGCTAACGAGGTTCGTGAAATGATAGATGATGAAGGGCAACCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCGTAACATTCCACTTGGTCTTCTTCCTCAACAACTCCGATCTACACCAGCTGCCGCCATGACCGACGCTACCACACTACCTTTTCAAACACTACATCTTCCATCCAATCGTCTTGCGT
TTTCAAATTCCGGATCTTCTTCAAGGTCCCTTTCAGATTTTTGGAGATTCAAATATGACGTATGCACAGGGAGTTTGAAGGCCTTGAGCCAGCAAAGATCGATTCCGGTTATTGATTCTT
CTTCCCCTGTTTCACTCGACCTCAAACCTATTTTAAACGAATGCCAATTTGATCACGTCATTCATGATGCTCAACGGTTGGATGACTCGGTTGTTGTTTTGTG
GATGGCAAAGTGGTGCA
GGAAATGCATATATTTGAAACCAACATTGGAAAAATTGGCAGCTGATTATCACCCAAG
GGTAAAGTTTTACTGCATTGATGTCAACAACGTCCCGTATCAGCTTGTGGTTCGGGCTGGGG
TCACT
AAAATGCCAACTATACAGCTATGGAAAGATGGGAAGAAACAAGCAGAGGTGATCGGAGGTCACAAAGCGTATTTAGTTGCTAACGAGGTTCGTGAAATGATAGATGATGAAGGGC
AACCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTTAGGGAT ATAAAAGTAA AAGTTTGTCC TGTAAATGCG TAACATTCCA CTTGGTCTTC TTCCTCAACA ACTCCGATCT ACACCAGCTG CCGCCATGAC CGACGCTACC ACACTACCTT  TTCAAACACT ACATCTTCCA TCCAATCGTC TTGCGTTTTC AAATTCCGGA TCTTCTTCAA GGTCCCTTTC AGATTTTTGG AGATTCAAAT ATGACGTATG CACAGGGAGT TTGAAGGCCT  TGAGCCAGCA AAGATCGATT CCGGTTATTG ATTCTTCTTC CCCTGTTTCA CTCGACCTCA AACCTATTTT AAACGAATGC CAATTTGATC ACGTCATTCA TGATGCTCAA CGGTTGGATG  ACTCGGTTGT TGTTTTGTGG ATGGCAAAGT GGTGCAGGAA ATGCATATAT TTGAAACCAA CATTGGAAAA ATTGGCAGCT GATTATCACC CAAGGGTAAA GTTTTACTGC ATTGATGTCA  ACAACGTCCC GTATCAGCTT GTGGTTCGGG CTGGGGTCAC TAAAATGCCA ACTATACAGC TATGGAAAGA TGGGAAGAAA CAAGCAGAGG TGATCGGAGG TCACAAAGCG TATTTAGTTG  CTAACGAGGT TCGTGAAATG ATAGATGATG AAGGGCAACC TTAATTTCTT TCTACATATG TTCTTGTTTT TTGTTCTTCT AGAAATGGAC ACATAGATTT GTATATACTG CAGAGAATAA  GCAATAAACT GTTTTTTTTT TTTTTTTTTT TTGCCATATA ATCCCTAATC TGTTGTTTTG GTATCACTTT GTAATTGTAA CCATCATGCA ACAATGCATA CTCTGAAAGC TCATCGTTTT  CGACCATGTG TAAAAACTAT CCGTTACTCA TAAAGAAGAA ATATTTGTTT GTTTTTCCTC ATTTCTTTTT CTCTTCGATG GATGGATGAC CGGATAAAGG ATGTTACGGA CCAATAAGTT 
ATGGAATGAT ATTGTTTGGG CTCTCGT 

Retrieve as FASTA