Entry information : HaTrx06 (HanXRQChr12g0378471)
Entry ID 14494
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-12-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-12-07 (Christophe Dunand)
Peroxidase information: HaTrx06 (HanXRQChr12g0378471)
Name (synonym) HaTrx06 (HanXRQChr12g0378471)
Class Other Thioredoxin    [Orthogroup: Trx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrx06
start..stop
S start..stop
ThasTrx06 319 4e-111 1..251 1..259
AtTrx06 315 2e-109 76..251 86..261
PpaTrx01 260 1e-86 9..251 100..361
CbraTrx04 206 3e-65 66..251 207..390
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 113188361..113188516 156 N° 2 113189145..113189357 213 N° 3 113201573..113201676 104 N° 4 113201789..113202071 283
join(113188361..113188516,113189145..113189357,113201573..113201676,113201789..1 13202071)


exon

Literature and cross-references HaTrx06 (HanXRQChr12g0378471)
DNA ref. HanXRQ genome:   HanXRQChr12 (113188361..113202071)
EST ref. GenBank:   GE522706.1
Protein sequence: HaTrx06 (HanXRQChr12g0378471)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   27731.02  
PI (pH):   %s   6.17
Sequence 292
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARVASNPIGLHKFRPSHFHPATTSLNPSVHSTNRKLRYQKLYCQTEPNPTEIVESGTDVDNKNIEDTSSPSGVPFPELPNKSLNRRIAIVSVLGAVGLFLSGRLDFGVSLKDLSAAALPYEEALSNGKPTVVEFYADWCEVCRELAPDVYKVEQQYKDRVNFVMLNVDNTKWEQELDEFGVEGIPHFAFLDGNGNEEGNVVGKLPKKYFLENVDALASGKPSIPHARVVGQYSNAEARKVHQVTDPRSHG

Retrieve as FASTA  
Remarks Complete sequence from genomic and EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTCGAGTTGCTTCCAATCCCATCGGACTCCATAAATTCCGGCCATCTCATTTTCATCCGGCCACAACCTCCCTCAATCCCTCCGTTCACTCTACCAATAGAAAGCTTAGATACCAGA
AGTTGTACTGCCAAACTGAACCTAATCCAACCGAG
GTCCTCTCTCTCTCTCTCTAAACTTATGTTACTTCGTTTCAAATTAATTGCTGTTTATTTAGCATTCGAATGTGCAAATTTCACA
GAAACTGCATCAATTTTGACTGAGACAAATAGTAGTTTTCAAACAGCATTTACTTGCCACTCTGTTGTAAATTCCTAATGGTTTTATCTTAATTACTATATTTCAAATCGAACAAATCTG
AGCATCTATTCAACAAATCCGAATAGAGATGATGAGAATATCTTCAATTTAAGTCTCTAAAAGCTAACAAGTTTATGTTATCCATAAGTAATTTATAGTGTTTTTTAATAAGGGACGCTT
AGCATACGTGATGTGAGTGATTGCGCATCAGTCATCGGATTTTGGGACGTAAACGCGCTTTTTAAAACCAAGGCGTATAAGCATTTGTATCTCATCAAGGGTTTCCCTGTTTCTTTCTTC
TGCTATATATATAACAGTTAACAAACACTTCACTAGATATAATTGGAACACTGTTATATCCGTCATCTTCTTCGATAGGTTTTATTATGAGTTTATTATATTTTTCAAGTACACAACTCT
AATTATCAATGAAATGGTTTCAGAATGTGTTTTATATTTTGCTTGTTGATACATTGAATGCAGATTGTGGAGTCTGGTACTGATGTAGATAACAAGAATATTGAAGATACGAGTTCTCCA
AGTGGTGTACCATTTCCTGAACTACCCAACAAAAGCCTTAACAGGCGAATTGCAATTGTTTCAGTTCTTGGAGCAGTGGGTCTATTCTTATCAGGCAGACTTGATTTTGGTGTTTCTTTG
AAGGACCTTTCTGCCGCAGCATTGCCTTATGAAGAG
GTTACTTTTCTCACTAGCAATAGTTACTTTTTTTATATCAGTTTTATACTGATTTGTGCAGATATGTGGCTTATAGCTTTATAT
TGTAGTATTTGTATGAGAAGCTTAGCGATCATAATCAGAATAAGCAGTCAATTGAGCTTTAGAAGCATAAAATATACCTTGATAAGAAGCATTAAGAAGATACCTCAATAGATGCTTTAC
AAAACGCATATGGACAGATTCCGAAGCTGGATAGTGTAAAGATAAGATAAGATATATGGTCATTGTAGGTAAATTAACTTGCCTATTATGTATCTTCTATACACCTCAGCATTATGTAAA
TGTGTCATCTTGATTGATGATTAAGAGTAGGATTCATGGGAAGTTACAGGGTTTACTATTCAGGACGCCGACTTCTTGTAGTAAGTGCATAGTGTACTTTTTCTGAGATGAAAACAAACC
TTGTTCAGTTTTTGTTACTTCCAGTCCCAGAAAATGATGTGATAGACCTAATTTTTTCATTTGAATGTGAGCAAGCTGCTCCGTAAGTTTATTTAATTGAGAAGAATCACTTGTTGCGCA
AAAGATCATCAATATATAGTAGGGGGTTTCCAGCCTAGTAATATCAAGGTGGTGTCCATATCCATGAGGTTGAGGGTTCGAGTTCGGTAGTGTAGAATTAGGAGTAGGATTAGTATGTGT
GTGTGTAGAAATGTTATACAAGGAAAACTATGGATTGACTCTTGTTGTCTTTCCCTCTAAACAAAGAATAATCTGCTTTTGATTGCTCAAATCCAGATCGCAAGGCGGTAGACAATTTGG
AAAATGACTGTCTTGGTGTCTCTTTTAAACCCTATAAAAAAGCTTTTCGAGCTTACACACAAGAGACTAAGTAGAGACCAATTTCTTTTCACAGGCTCCCTTACCACACTATAACCTTCT
TCAGGTATATCACTGATGAGGATACGTCCCTAACCGGACCGAATCATTGCTACAAACAGATCGGACCGGGCCTTGCACCACGAAACGGTCCGGTGTAACTAACTAGGCCCCACCTCATAA
CCGTCATGACAGCGACTGGTCCGACCCTAACTAACTCGCCACGTCAGCACACCCAAAAGCTATAAATACCCCGCCAAAGCCTCCAGCAAGGGGTAATCGCTACTCTCTCTCTCCCTGACT
TATTTCCTCCTCACAAATACTTATTCTCACGCCCGAACTTGGTCACAGAGAGGCCCCCCTCCCTGTGACGAGGCTAACAGCGTGCTTGTCTCTTGTGATCTTGCAGGTCTCTTGTCGGAT
CATCTGAAGTTCTACTCTGGCCAGTTCGTATCAACTGGTTTTTGAGTCTTCAGTGGCGCCATCCCCTCGAATTCACATAATTCATTTCGTTGTTCCCATTTTTTCGAAGTAATGGCAGAA
TTACCAGCAGTAATCTCCACCAGTCCTTTCCCATCTTACAATGATATATGGGAAGGAAATGCTAATTCCACAATCGCTCCAGCAGCAGTTATCGCTTCAGCAGCCTCGATAGGCTCCACA
TCGGCTCCTCCAGCTGCAAATGTTGTGGGTGGAAGTTCTGTCACCACACTGTCCGTTACCGCTCCAGTTGTCACGCCACTACCGAGTTTTGACAACGCTTTCCTCTTAAGGAATGCTGAT
CTGTTGCGACAGTTACAGCAGCAACAGCAGAGAGACGAGATGCTGCAAAGTCTCCGAACAAACTTGTTTACCAGTGCCTACTCAGGGGGAAACCCAGTCTCCGTCGGTCCTTTTGCTTCT
GGATCTCTGGTAAGTTCTATGATCTCCACTTCTATACCACATGTTACACAATTCTCATCCGTAACAAGTGCTCCGATGAATAACGGTCTAAACGACCTGTTTCTCCAGGGATCTTTGGGT
TTAAACCCCCAAGACCAAGAGCTACTCATGCCATATCATCCCACGTCTATGACTTCGCAGTCAAAGTTCACGCTATGGATTGTCAATGCTCCACTCCCAGCTAAGCTGAAGATGCCTCCC
ACGTTAAAATTTTACGATGGTACGTCGGACCCGGACGACCACATGTTCGCGTTTGCCGGAGCGGCTAAGGTCGAGCAATGGCCAATGCCGGCTTGGTGTCTTATGTTCGCCCAAACTCTC
ACCGGATCGGCTAGAGTTTGGTTCGATGGGTTGCCAGAGGGGTCGATCGATCACTTCGAGGACTTCCGACGTATATTCTTGCAAAACTTTTGTCAGCAGCGTCGCTGCAAAAAAGATATT
ACTGAGGTACACCACATCAAGCGCCGCGACGGAGAGTCCGTAGAAGATTTTATAGACCGTTTCAACCGGGAAAGTATGCAGATAAGTGGAGCAGTAGATCAGCTCCGAGTATCGGGTTTC
TGTCATGGTGTACGGAACAATCAATTGGTGGAAAAACTTCACGAAGATCTCCCAAAGACCATGGAGACACTCATGGAACGGGCTCGAGCTTTTGTTCGAGGGAAGAGTGCTTGCGGCCAA
CCGAACGAAGCGACTGCCAGGAGCTCCAAAGCCCGAACCACGTCATGGAGACGGAACGCATCGCCACCAAAAGATAGGAGCAATAACTGGAACAGAAACCGTGGTCCGTATCAAAAATCC
GATCGAAGCAGTTTTCGGACAGGAAACGTACGATTCAACAGTTTCTCTGAATTATCAAAATCGCCGAGCGAAATCCTCAGCACGGAAAACACTCGATTCCCCACGCCATTAAAGCAACGG
CCCACCTCAGATAAGCACTCCAAGAAATATTGTGAATATCACCGAGACAAAGGCCATACAACTGATGAGTGTTGGGCTCTAAAGCAAGAAATCGAAAAGGCCGTTCGATCCGATAAACTC
TCACATCTTGTAAAAGAAGTAAAAGATGGAAAGAAGCCAGCAACAGTAGTTGACAATCCGAACACCGAACCGGGAATCAATATGATCCGGTCAACAGAACCGAGAGGAATCAAACGGTCG
AACCAGCATATGGCAACATGGATGCGTCAGCCGATGTATTTTCCTCCGGTCGACCCCGAAGACGCTCGGGACGGACCGATCATAATTTCAGCTGTTGTCGCCGGACACCTGGTTCGACGT
ATTTACGTGGATGGAGGAAGCGCCTTTGAGATCATGTATATCCAGTGTTTCCAACAGCTGAATCCCCAAACAAAAAGGAAGTTAATCGAAGTATCTACCCCATTGATAAGCTTCTCGGGA
GAAGTAGTCCGTCCGATAGGACAGATTACTCTTCCAACCACATTCAAAGACGGTAGCAAAAGCAGGACGGTGCCATTAACTTTCCTTGTTGTTCGAACTCATTCTTCGCACAACATAATA
CTCGGACGCCCCGGATTACGAGCTCTTGGAGCGATCAGCTCGACAATACACGGAGCTATTAAGTTCCCTACCGAAGCCGGTGTCGCAACCATCTGTTCGGAATCGAATTCGCTGGTCGCT
GAGGTAAGGCATACAGCCGAAACAAGCTCTAAGAAGTCCGAAGTACCTACGGAGCTATGGGCAATCAATCCGGATTTCCCCGAACAACAAGTGGCTATCGGCGCTCAACTCCCAAAACGA
ACGAAGAAACTCTTATGAGAATTGTTAAGCAACTCGATAGATGTCTTTGCGTGGCAGCACTCTGATATGCAGGGAGTCCCCAGATCGATGGCACAGCATCACCTAAATGTAAAAGATTCA
GTCAAACCAATAGCACAAAGAAAGAGGCACATGGCACCGGATCGAGCTAAAGCCATAGCAAAGGATGTTAAAAGCCTCCTAGACGCGGGGATCATTCGGGAGGTTCGGTATCAAACATGG
GTATCAAACCCCGTGATGGTACGAAAAAAAGATAACTCATGGAGAATGTGCATCGATTTCACCGATCTAAACAATGCGTGCCCGAAAGATTGTTTCCCTCTCCCAGAGATCGATGAGAAA
ATTGACTCCGTTGCAACATTCAGGCTAAAATGTTTTTTGGACGCTTACAAAGGCTATCACCAAATACAAATGGCGGTCAAAGATGAGGATAAGACGGCCTTCGTCACCAATGAAGGAGTG
TTTTGTTTTACTAAAATGCCGTTCGGTTTGAAAAACGCCGGTGCTACGTACCAGCGTCTGATGAACAAAGCTTTTAAGGACCAGATCGAACGAAACGTGGAGGTGTACGTCGATGACATC
GTGATAAAAAGCCATGATGAGGCCGCCATGCTAAAAGATATACTCAAAACATTTACTCGGCTCCGAAGCATTAACATGAAGTTGAATCCGAAAAAATGTACATTCGGGGTAGAAGAAGGC
AAGTTTCTCGGGGTCATGGTCGGGTCAAAAGGCTTACGAGCCAACCCCGACAAAATTGACGCTGTCCTTACAATGAAGCCCCCGACATCAATTAAAGAAATTCAGTCCTTAAATGGACGA
TTGGCTGCTCTCCATCGGTTTTTGTCAAAAGCTGCAGACCGATCGCTCCCATTCATGGACGTTCTCAGAAAGAGCTTTAGATCGGAGTTTAAATGGACGGGAGAGGCCGCACGAGCTTTT
GAAGAACTTAAAGAATGTTTGGGCACCCTACCAACCCTCAGAGTACCGGAAGAAGACGAAGTATTAACGGTATATTTAGCTGCATCGTTCGGAGCCATCAGCGCGGTATTAGTTGCCCAC
CGAACTGGAAAACAAATCCCCATTTATTATGTAAGCCGAACGTTAAAGGACTACGAAACAAGATACTCAAATTTGGAAAAATTAGCCTTGGCCCTAGTCCATGCTTCAAGAAGGCTTCGC
CGATATTTTCAGGCCCATCCAATCGAGGTACGAACGGACCAAAGAATCCAACACGTTCTCCGACGACCCGAGGTCTCAGGCCGAATGGCGAAATGGGCGATTGAGTTGGGCGCATTCAAC
ATAACCTTCCGAACTAAAGGTCCGTTGAAAGGACAGGTGATAGCTGATTTTTTGGTCGAAATACCGGAAGAGAAAGAAACTGAAGAGGCAGGTAAAGCTCCGGAGAAGCCATGGTCTTTG
TATACCGACGGTGCCTCTAGTGCTGAAGGATCAGGAGCGGGCCTAATTCTCACCGATCCAGACGGAACAGATGTAACGTATGCGCTCCGACTAGAATTCAAAAGTTCCAACAACGAGGCC
GAGTATGAAGCTCTCCTGGCCGGCCTACGCCTAGCACAGAAAGTCGGAGCCAAGAATGTTATAGCCCATGTAGACTCGCTGCTCGTAGCAAATCAGGTAAATGGAGAATACGAGGCGAGG
GAAGCGAATATGATCGAGTATCTCGAGCAAGTAAGGCAGGCAATGGCTTTGTTCGAAGCATGTAGGGTCGAACATATCCCCCGAAGCAAAAACAAAAAAGCGGATGCATTAAGCAAACTG
GCATCGGTATCATTCAGCCACTTGGCCAAAGAAGTGAGAGCTTGGCCAAAGAAGTGAGAGTGGAAGTTTTAGCTACACCGTCAATCGCAGCTCCGCAAGTAATGCAAGTTGAAGTTCCAC
CACAAACATGGATGACGCCGATAATTAATTATTTGGTGCATGATGTTCTGCCAACTGACAAAGCGGAAGCAAGAAAGGTTCAGATCAATTCCCTCCAGTATCAGATGCAGGAAGGAGGAT
TGTACCGAAAGACCTTTCTCGGACCATTGCTAAAGTGTCTGGATCCGGAGCAAGCTAGTTACATCATACGGGAAATACACTACGGCATCTGCGGTATCCACGCCGGACCCAAAATGATCG
TAACAAAGGTAAAAAACGCAGGGTATTATTGGCCCGGAATGCATGAAAGCGCCGTAAAAGAGCTCTAGCAATGTGACGAATGTCAAAGGCACGCACCAACCAGTCTCCGAGCAAAAAATG
AAATGATACCAGTAACCGCCGCATGGCCTTTTCAAAAATGGGGAGTTGACATCGTCGGACCTTTTCCGAGATCGAGCGGAAGCGCACAATATCTGTTGGTCGCTGTGGATTATTTCACCA
AGTGGGTAGAAGCTCGTCCGTTTACAACCATCTCCGGCTACAATGTGACGCGATTTTTCTGGGAGCAAATAGTGTGTCGATTCGGCCTACCGCTCTACATTATAAGCGAAAATGCAAAAC
AGTTTGCAGAAAACCCCTTCAAGCGATGGTGTGAAAGGTTAAAAATCAATCAAGTCTTTTCCTCGGTTGCCCACCCTCAGGGCAACGGGCAGGTTGAACAGATCAATCGACGCATCGTCG
ACGGCATAAAAAGAAGGCTAGGTCAGGAAGGAAAAGGTTGGGCGGACGAACTGCCGAACGTCCTATGGGCACACCGAACGCTGCACAAGACCAGCAACGGTGAGACACCGTTCAGCTTGA
CCTACGGTACCGAAGCAGTAATTCCGGCCGAAATCGGGCTCCCAAATCAAAGATGCAAGAATTGGGAAGAAAACGAATGTGAACTCCGGTCCAACCTTGACCTGCTGGAGGAACGCCGAA
ACATAGCGGCAATCAAAGAGGCTCGGTATAAGAAAAAAATCGAAAAGTATTACAATGCTCGGGCTAAAATTTACAAGTTCAAAATCGGAGATTATGTGCTCCGAAACAACGACGCAAGTC
GCACCGAAACCCCCGGCAAACTAACCCCAAAGTGGGAAGGGCCATACCGAGTCAAGGAAGCCAGTGAGAAGGGCTCGTATGTGCTAGAGAAGCTTGACGGAACCCCAGTGCCTCGAACAT
GGAATGGGGTACACTTAAAAAAGTGCTTCATGTAAACAACCAGCTACGACTGAGGAAGATCGCTAATTTACATTTTTAGTATTTCCAGATTTCAATATGTAAATCGGGAGGGTATTACCC
CGATAACTGTTTATTTCCTTTGTAATCGGGATGTTTTTTCCCCGAACTAGTAAATAAAGCGATCTACATCTTTATAAACATAAAGATAGCATACATATAAGTTCGAACAAAATTTCTAAA
CGTGCACGAACGGGCCACGACCCATGCCTCGCGCTGATCGAGAAGGCTTAAATAGTTCAAAAAGAAATTAAAATCTATTGAGCAGGCGAAGCACTTCATCCGGTGCGATCGCCAAGTTAA
AAGTATACGGCTAAGGTTTGGACGCAAACCGAGGCTAAGTAACTAAGTTAAAATAAAAATGACTTAACACAAAAACAGTCATTCGTTGTGCAATTAAAACTGTTTCAAACGAAGCATACC
AATAGAACACAGTGTACGGTTACAAAAAAAAAAACAAAAACATTAAACTTGAACTATATTATCATCGTCCCCAACAATGGGAAGTTTGCTTCTTTGTTGGATAACAGGTAGGGGCTCGTC
TATCAAATCAGCTACCTTGTCAAGAACGGAGATATTAAGTTCATCAAAAGCTTTCACCGCGGCGTCCAGGGCACTCTGAGCTCCGGCATCGTAACCTGGAACCTCCTCCGCAGAACCGAC
CAGATCCTGCGCGGCCTTAAAACCCTGTTTTATCCCTTCATTCGCCCCAACCGCGTTGACACTGTTGACCAGGTCAGCAACCACCTTCTCCAATTCAGGGCTTTGATGCACCAACTTCAC
AACCCATGCAACCCCCTCGGTCAAAAACCAGTGCTTAGTGAGTTTGAGCTCCGACAATTGCGCATATGCCTCAATCATATCACGCTCGCACCGAATCAACATCCCTCTTGCTTCATCAAT
CGTTGTCTTGTGCGACTCGATCTCCCTGTCACGAGATCTCTCTATTTCGTCTTTAGCTGCAAAGAGACGATGCTCCAAAGGATCAATAAACAATAATGTATAAAAAAAAAGGGGGAAAGA
CGAGAAGGTTGTAAACGTACCATCAACCAAGCGATGGTAATCAGCCAGAAGCTGATCGTGAGACGTCTGCATCTCTTTCAGCTCGGCGGCATGGTTCATCTCTGCTCCGGTTAATTTTTT
CTCCAAATCAGCAAGTTTTGACTTAGAAGTCTCCAAATCTTGAAGAGCTTTGTCACGAGCCTCATGGGCCGCAGCGGCCGAAGCTTGAGAAGACTTGGTAACTTCTTTGGCTTCCGATAC
CTGCCCTTTCAGTCGGTCAACTTGAGATCGCAGGGAAACTAGCTCCTGTTTCGTTTTAGATCGAACATCACCCTCGCCTTTCAAATGAGCAATCTCACGTTTAAGCTTGTGGCACAACGA
CTCCGACTCGACCCAACGTTTGTACGTCTCCACCACCAGAGAGTTCGACTGAGCTTGATTCAGCATCAAGGTGTTTCCAAGCTCCGGTCCGCTCATCTTGCGGTAATGGGAATGTTCTGC
AGGAGTTCCCAAATGAAACAAAGACATCTTGGCCGAAAGAGCGTCCACGATCCTATCTTTATTCACCAGCGACCATTCCGGCACATACTTCTCCAAAGCATGAGCCGCATCCGCACCTTC
AAAATCGCCCGAACCTAATTCCCGAGACAAGAACACAGCCTCAGTGTCATACCAAAGAGGGGAGGAAGAAGCACTGTCCCCACCATCAAGCGGCGAAGAGCTTGGCCTAGACACATTAGA
TGCAACTCCCGTAGTAAACTTACCCGAAGGAGAAAGCACAGTTTTCTTGGGGTCGGACGTGCGCAAGTCCGTAACAACCTTAACACCCCCCTTACCAAAAGACAACGGGCTCACAGGAGT
TTGCAGCGGATGATCCCGCGGGGTGCGGCCCTCATGGAGATGAGCATCCAAGTTTGCCAGCACACCTCCAGCGGTAGAGAATTCGGTAACTTGGTCGTCATCGTCGAGTGTAATTGTTTT
AAAATCTGCCTTCGTCCTTTTCGGCTGCCTGGCTTTTGGGTCAGTTTTAGTGGGAGCAGCCCGTTTCCTCTTCAAAGCAATTTGAGGCTGATCACCTTCGTCTTCACCATCTCCCCCGAC
GCCCTCATCTTCGTTCCGATCATTATCTCCTTTCTCCCCACTAGCATGTGTCTCAGAATCTCCGACAGAAAGATGGACCCCCTCATCCTCGATAATAATTTTAGAACCGGAACCCTTCGT
CATCGATGAACCAGCTTTCCGACCCCCAGCATCATCCGCCGTAACCATCGCCTGAGCTTGAGCAGCTGGCGACACAATAGGGGCCGAACCTGAAGCACCTTGACCACCAGGAGCCTCCGG
CTCACGAATCGGATAAAGATTTTGTTGCACGAGCTGCAAATACGGAGTATCACCCTTCGGAGTCTTGGTAGCACGAACATCCAGCTCCTTCGAGTCGAAGGACTTCAACCGCAGCGCCTC
CTTCAAACCCATAACTGCACATGAAGGCAAATGATAAGTAATATCTACCAACCTAAAAAAGAAAAAGAAGGGGGCTCGAATATAAATAAGTAACACATAAATGTATAAGAGACTCTATAC
AACTAACCCTCTTTGTTCCACCGAAGGGTAGGATACCACTCTGGCTCGGCCCACATCGTGCTGATTCGACCCATGACGAGGATGTGTTCCGGATATTTCTGTATACGTCCGGCCTCCTTT
ATCAAATCGGCGTATAGCTTCTCGTTATACGAAAAATCTTCAGGAAGAGGAGGCGGGAGTTTCGACTTTTTTATCCTCCACACCATGAATTCCGGAACGCACCGATCATCTACTAGAAAA
AAGTGATCCTTCCAGTCCTTTATACTCGTGGTGATCCATGTATAGCAGCAAGAACTCTTGTCCCTAACTTCAAAAGTATACCAATTTCCGGACCGGTTCAACTTGTAGAAAGCCCGGAAC
ACATCCAAATCCGGCTCGGACCCTAAGCTACGACAAGCCAACTCAAAGTGACTGATTTTGGCAAGGCCAAAAGGATTCACTTGAGTCAAGTGTACCTCATGAAAAAGGAGAACCTCAACC
AAGAACTTCGTCAGAGGCAGACGGCAGTTACAGTAGTCGAAAAAACGGGTGTAAATCCCAATCTTCCCCGGGACGAAAGGGTAGATAGGTGTATCTTTTTCCGGAAGAATAGGGTTTAGC
GATTTAGGAATCGCATAACTCTCCACATACCAGTCTAACCCCTTTTGAGTCAAGACATTAAAGCAACCAGAAAGATTGCTTTTATTCGCCATAACAGAAAAAAGAACTTACTAACCTGAA
TAAGCGGATCGATGCTCTTTCTCGCCAAGAAAGATGAAGAAAGGAAGAGAGGAAGATGAAGGATAAAGGTATAAAGTAAAAAAGTAAAATTGAGAAATCACCTCTCCCCTTTTTATAGGG
ATATGAAACCGCCTCAAAGGCCCCAATCAAACAACGACACGTCATGATAACTGACGCACACCAACCGTCACATCGGGCGGAAAATTTAAAACGACTGACAGTCACCAATCTTAGATCACC
GCCCAATTTCAAAATTTTAAAACCGCCAAGCAAAAAGACCGTGAACTCCAGAACACTTTGACAAATAGTTCGACATTTTTGCTAAACAAACATTACGAACTAGGGGGACTTGATGAGGAT
ACGTCCCTAACCGGACCGAATCATTGCTACAAACAGATCGGACCGGGCCTTGCACCACGAAACGGTCCGGTGTAACTAACTAGGCCCCACCTCATAACCGTCATGACAGCGACTGGTCCG
ACCCTAACTAACTCGCCACGTCAGCACACCCAAAAGCTATAAATACCCCGCCAAAGCCTCCAGCAAGGGGTAATCGCTACTCTCTCTCTCCCTGACTTATTTCCTCCTCACAAATACTTA
TTCTCACGCCCGAGCTTGGTCACAGAGAGGCCCCCCTCCCTGTGACGAGGCTAACAGCGTGCTTGTCTCTTGTGATCTTGCAGGTCTCTTGTCGGATCATCTGAAGTTCTACTCTGGCCA
GTTCGTATCAACTGGTTTTTGAGTCTTCACACAAGAGACTAAGTAGAGACCAATTTCTTCACACAACCTTCTTCAGGTATATCACCATGTAAGAAAGCATAGGAAACATCCATTTGCCAT
ATATGCTGACACATACCCATCAACTTTCAACTTCTTTTCAAGATTCACTGACATCCTATAGGTTTCTTTCCAGGAGGTAAGCTTGCAAGTTCCCAAGTGCCACCCAGTAATTTTGTATTC
ATCGCATCACACCATCGCTATCTTGTTTGAAATTTTTTGGATCACTCTGAGAAACAAGGAGTAGGACGCATTTTTTTTGTTTTGAAATTGTAAAGTAGTAACTTGATTTGCCATATGAAC
ATGTTTCCAATGATGTGAATGAGTAACACAATATTTAAATCAAGAAGGGATTTTTGATTCTTCTAACCGCAGTAGGAACAGAAGGAGAAGAAGAAACACAAGGATTAAGGGCTCCTTATG
TATCTAGAGCATGAACATATTTACTTAGAGAAAATTCATCTTCTATAAAGAAGTATAACCCCGATGGGAACAAACAAGGACGTAATGTTAATCCATAGTTATGGAGCCTAGGCGCATTGG
TGATTGGCCATAAGCCAGAGATCACTATCATTTGTACCTTGGACATATGCTTCTGAGATGGTGGAAATGAACAACATACAATACAGACATGTGCATTGTTGGATATCCAGAGTGAAGACT
ATATTTGGCTTCATTGGTGCCAAATGTTGAGACGGAGTTGTACCTTCCACATATCCAAATGTGACAAGGGTTGAATCATTATCTTCCAGTAACAATAAATAGGGTACAAGCAAATTTATC
AGGGTTAAGATTTTTTCTCAATTGACAACTAAGGCCATACAAGTTGTGTTGTTACTATATGACTGGATTTCGGGTTTCCGGAAGCAGAAGGTGGTTGTCGTCAAAGCAAATTTCGGGTTT
GGCCAATGATGATAGTGGTAAGACCACACGAGACATGGCCAGAGAAATAGCTTCCGCACCTAGTCATGGTGACGGCTAGGATTTTGCAGTCTTTAACGACTAGAATAAAATGTTTGACAT
ACCAGTCATATCAGTACAGGTAGCTAAGACGAGTTTTACCTTCCAGTCATCGTTCACTTGATGTTGGTCATACATACATCGGAAGGCTTTTTAATTACTCAAAATGTTAAGAAACAAACT
AACTAAGCGCGTATTATTAACTATAACTCAAACAAACTTAGCTGCTTTCTTCATTCTTTCAATTTAAGTCCTCCAACTTTTGACAATGACAATTCTGACCCTTCTCTTTATATTTTCACT
TGACATACTTGTACATTATTCTTGCTTGCAATATCATTTAATATAATTAATATCGCCTTTTGTTAATTTGACGCCTAACAGTCTGTGTTTGTGTTTATTACTGTTATGCATTATGATTGT
GTCATCAACAGGCCCTTTCGAACGGGAAGCCTACAGTTGTGGAGTTTTATGCTGATTGGTGTGAGGTATGTCGTGAATTAGCTCCAGATGTTTACAAAGTGGAGCAACAGTACAAGTAAA
TCCTCTTTTTTTTTTTTTTTTTTACCTTTTTTCCTTATTAACTTCTCTTTTAGGAGATAATTAAAAAACATTCAAGCTTAATAGCTCAAGAACTTAATCGAATCCAGGGACCGAGTAAAT
TTTGTCATGCTTAATGTCGACAACACAAAGTGGGAACAAGAACTAGACGAGTTTGGCGTCGAGGGTATTCCACATTTTGCATTTCTAGACGGTAACGGTAACGAGGAAGGAAACGTTGTG
GGAAAGCTTCCAAAAAAATACTTCTTGGAAAACGTTGACGCACTTGCTTCGGGAAAACCCTCCATCCCACACGCACGAGTTGTTGGTCAATATTCAAACGCAGAAGCTAGAAAAGTGCAC
CAAGTAACCGACCCGAGAAGTCATGGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTCGAGTTGCTTCCAATCCCATCGGACTCCATAAATTCCGGCCATCTCATTTTCATCCGGCCACAACCTCCCTCAATCCCTCCGTTCACTCTACCAATAGAAAGCTTAGATACCAGA
AGTTGTACTGCCAAACTGAACCTAATCCAACCGAG
ATTGTGGAGTCTGGTACTGATGTAGATAACAAGAATATTGAAGATACGAGTTCTCCAAGTGGTGTACCATTTCCTGAACTACCCA
ACAAAAGCCTTAACAGGCGAATTGCAATTGTTTCAGTTCTTGGAGCAGTGGGTCTATTCTTATCAGGCAGACTTGATTTTGGTGTTTCTTTGAAGGACCTTTCTGCCGCAGCATTGCCTT
ATGAAGAG
GCCCTTTCGAACGGGAAGCCTACAGTTGTGGAGTTTTATGCTGATTGGTGTGAGGTATGTCGTGAATTAGCTCCAGATGTTTACAAAGTGGAGCAACAGTACAAGGACCGAG
TAAATTTTGTCATGCTTAATGTCGACAACACAAAGTGGGAACAAGAACTAGACGAGTTTGGCGTCGAGGGTATTCCACATTTTGCATTTCTAGACGGTAACGGTAACGAGGAAGGAAACG
TTGTGGGAAAGCTTCCAAAAAAATACTTCTTGGAAAACGTTGACGCACTTGCTTCGGGAAAACCCTCCATCCCACACGCACGAGTTGTTGGTCAATATTCAAACGCAGAAGCTAGAAAAG
TGCACCAAGTAACCGACCCGAGAAGTCATGGCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CACTTAACTA TACACGCTGG ATTTCCCCAA AACTACTGTA ATTTGGCAAT TTTAAACTCC TCGGCGACCG CAGAAGATAT TCCAATGGCT CGAGTTGCTT CCAATCCCAT CGGACTCCAT  AAATTCCGGC CATCTCATTT TCATCCGGCC ACAACCTCCC TCAATCCCTC CGTTCACTCT ACCAATAGAA AGCTTAGATA CCAGAAGTTG TACTGCCAAA CTGAACCTAA TCCAACCGAG  ATTGTGGAGT CTGGTACTGA TGTAGATAAC AAGAATATTG AAGATACGAG TTCTCCAAGT GGTGTACCAT TTCCTGAACT ACCCAACAAA AGCCTTAACA GGCGAATTGC AATTGTTTCA  GTTCTTGGAG CAGTGGGTCT ATTCTTATCA GGCAGACTTG ATTTTGGTGT TTCTTTGAAG GACCTTTCTG CCGCAGCATT GCCTTATGAA GAGGCCCTTT CGAACGGGAA GCCTACAGTT  GTGGAGTTTT ATGCTGATTG GTGTGAGGTA TGTCGTGAAT TAGCTCCAGA TGTTTACAAA GTGGAGCAAC AGTACAAGGA CCGAGTAAAT TTTGTCATGC TTAATGTCGA CAACACAAAG  TGGGAACAAG AACTAGACGA GTTTGGCGTC GAGGGTATTC CACATTTTGC ATTTCTAGAC GGTAACGGTA ACGAGGAAGG AAACGTTGTG GGAAAGCTTC CAAAAAAATA CTTCTTGGAA  AACGTTGACG CACTTGCTTC GGGAAAACCC TCCATCCCAC ACGCACGAGT TGTTGGTCAA TATTCAAACG CAGAAGCTAG AAAAGTGCAC CAAGTAACCG ACCCGAGAAG TCATGGCTAA  ACAATCCAAA CTATTTAATG TATTTGTAAT GTAATGAAAT AACAACAATT ACTTGTATCA ACTATCAAAC ATTCAGACCA CACAAAAATG TAATGAAATC ACATTTTCTT CACCTAACAA  CATTTCCTAA CAAGCTGTTA GTTGAGGGTG AACTCTGCTC ACTTAACCAT ATATCCTGCA CAGAAACAGG TGAAGTATCT TTCCCATCTT CCGCTATCTT TAAACAGTCC GGTATCACCT  GAGGAACACT CAACCGCCGC TTGCTTCCTA TTGCCGCCAC TTTTTTTGCT ATTGTCCCGC CTATTGATCT CTCACTGCCA TTAAACGGTG ATGAGGAAAC TGATGATGAT GACATGGTTA  CATTATCATC AACCGTGTGC CATCCACTGA TCCTAATCTG TTCCAGTTCA TCCGCCACTT CTGTCATTGA TGGTCTCATA TCTCTATGAA AAGCTAAACA TCGAAACGCC AGCTCAGCCA  CTTTGTTAAT TGATGAAAGC GTCCATGCAT CTCTATTTGG CTCCAAAAAT GAGTCAATTA TATCATCCAC GCAACCTTTC CCGATCTTTT CTATAGCAAG AGCAGCGAGG TTTATTTCAC  TATGATGGCG GGAAAAATCA ACCACTTTTA AAGCAGTGAT GATCTCAACA AGAACCACCC CGAAGCTATA AACATCACTT TTATCTGAAA GATGGAAGTT TTGATGGTAT TGCGGGTCCA  CATAACCTGG TGTCCCTTGC GGAGCGGTTG ATATGTGTGA ATCGTCTAAC ATACCGAGTC TAGAAAGTCC GAAATCTGCA ACTTTTGAGT TAAAGTTGTA GTCTAGAAGT ATATTACTTG 
ATTTAATATC TCTA 

Retrieve as FASTA