Entry information : HaTrxH01 (HanXRQChr01g0000531)
Entry ID 14497
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaTrxH01 (HanXRQChr01g0000531)
Name (synonym) HaTrxH01 (HanXRQChr01g0000531)
Class Thioredoxin Type H    [Orthogroup: TrxH001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxH01
start..stop
S start..stop
HaTrxH05 204 2.09e-69 1..135 1..134
ThasTrxH09-1 197 8.88e-67 1..135 1..134
ThasTrxH09-2 199 2.92e-66 1..133 100..231
HaTrxH06 196 4.69e-66 1..139 1..139
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14497' 'join(2045920..2045940,2047645..2047767,2047861..2047983,2048058..2048210)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2045920..2045940 19 N° 2 2047645..2047767 121 N° 3 2047861..2047983 121 N° 4 2048058..2048210 151
join(2045920..2045940,2047645..2047767,2047861..2047983,2048058..2048210)


exon

Literature and cross-references HaTrxH01 (HanXRQChr01g0000531)
DNA ref. HanXRQ genome:   HanXRQChr01 (2045920..2048210)
Protein sequence: HaTrxH01 (HanXRQChr01g0000531)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   139
PWM (Da):   %s   15204.55  
PI (pH):   %s   4.87
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGHCFSSPRADEDETNSHAQLAGGNVTLITTKNAWDQKLAEAKTQGKIVIGNFSATWCGPCKSMAPYYIELSEKYPSLMFLTVDVDELTDFSTQLDVKATPTFFFFKDGQQIDKLVGANK
PELQKKITAIVDSQATINP*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGCATTGCTTCTCTTCGCGGTGAGTTTTCCTTGTAACAAAGAATTGAAAACTCTTCTCTTCGGTTTGTTCCAGTTTGAGCTTAGATGTTTTTGAACATATAGATAGTTGTGATGGA
ATATACAACTCATTGTTATGTTAAATGACAGACTTTAAGATATGACATAATCACATAAGTATGTTGAGTGGTTGGAGGATGGTCATTGCTGACTAGCTTCCATGGTTGCGTGGAAGAACG
TGTTAATACGATTATCTAAGACCAAATACTGTGAAAATACGTAAACTTATATGTGAATCATGAATATATAAGTTTTGTTATCAAAGTCATATGGATTTAAAGTTAGATGGCCAACGGTAT
TTTCTGCAAGTTATGCCTGAATTATTGCTTGTGTTATCCCTTTGTCAAGAACGTTTGTGCATCCTGAATATAGAGGCCACAATTTTAACCCTTTTAGAAGATAAATTGAAAACGGGTCCA
ACTGGTAAAATGCATACAACTATACAAGTATTTAAAAATGAAACAGGTAAACGGTTTAAACAGATCCAAAGCTGTCTTGTATTCAACTGCTTATAGTGTCCACACTTTTGTTTTAGTTAG
AAATATGTTACATTATTAAATTAATAGTATAGCTTTTAATCATATTTCATCCATTTAGAACTTTTGAAAAATCAAGAATTCCATGAGATTCTGTTTGCGCATTTTGACCATTTTCATTTT
CATTTTCATTTTCATTTTATATAATGTGGTTTTTGGTCGCATCTACATGATGTGAAATAAGAACTGATACGCGACCAGTGGCGGACCCAGGATTTTTTTCCAATGGGGTCCATTTTTTCG
GTGTTCAAAATTTTCATAACAAAAGGTTAAAATTTTCGGGTCGGTCCTTGTTCAGGTCGGGTCAGAGCGAGGTTTGAACTAGATTTAAAAAAAAACATAAAAATGAGGCTATACAAGGAT
TGAACCCATGACCTTTTGTTGTTAAAGAGGGAGGTTTACCACTAGACTAAATTTCCTTTTCTTTATATGGTGTCCACCTAATTGTATTTATGGGGTCCTTATAAAATTTAATATACCGGA
TCTACTAATTTTTTAAAAAACATTGGGGTCCGGGGACCCCGATCCATTCAATGTGGGTCCGCCCCTGTACGCGACCTAGTGACCCACAAAAAGAGTGAATGTTGTAAGCAGGGCCGGCCT
GTAGGGGGTGCGGGGTGGGTGACGGCACAAGGCCCAAACCATCCGAGGGACAAATCTTTTTAATTTTGTATATAATTTACGTTGTATAAGATAGAATACATATGCACTGAATAGAGAGAT
AACATAAATGAGTCCTTGTACTAGTGGTTATTGCCTTGCTTAAACAACAAGGAGATGCGGGTTCTAATCCCAACGTCTCCAAATTCTTTATTTTAGCTTATTTTTTGGTTTTTTAATGTT
AGTGGCATTTAATGCTTAATTTTGTCAACTGCATCTTTTCCTTTAATTAATAAATTACTTCCTAAACTTAGCTAAAAATAACTATTTAAATTACATCCACATAAATTTAGTGATTGGTGA
ATTAATATTAAATGGAGATTTTCGAATAAGGCCCAAATTTTTTATCACGCACAAGGCCAATTTTTTTTTTTTTTTTTTTTTTTGGTTTTCGGAGACGGCCCTGGTTGTAAGTTGCAACCA
AATACATCCTTAGTTTTTGAATTGACCATGTAATATGATACTTGTAGCCTCGGGCTGATGAAGACGAGACCAACAGTCATGCTCAGCTTGCGGGAGGTAACGTGACTCTCATCACTACCA
AGAACGCTTGGGATCAAAAACTGGCAGAAGCAAAGACTCAAGGCAAAATA
TAGTAAGTCATTAAACTGTATATTAATTAGTAATTTAGTATATTCTTCTTTATGAAGTATTAATTAATTA
TAATCTATGTTGTATGAACAAATAGGTGATTGGCAACTTCAGTGCAACTTGGTGTGGTCCATGCAAATCAATGGCACCTTACTACATTGAGCTATCAGAGAAGTATCCTTCTCTTATGTT
TCTGACCGTAGACGTTGACGAATTAACG
CGGTAAGAGTTACATACATCTGTGTGAAGCTCCATGTATATAAGCTTATGTTGTGATGAAATGAATTTGGATGCAGGATTTTAGCACACAAC
TGGATGTAAAAGCTACTCCAACATTCTTCTTCTTTAAAGATGGTCAACAAATTGATAAACTTGTGGGAGCCAACAAGCCTGAACTGCAGAAAAAGATAACCGCCATTGTTGATTCACAAG
CAACCATAAATCCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGCATTGCTTCTCTTCGCCTCGGGCTGATGAAGACGAGACCAACAGTCATGCTCAGCTTGCGGGAGGTAACGTGACTCTCATCACTACCAAGAACGCTTGGGATCAAAAACTGGCA
GAAGCAAAGACTCAAGGCAAAATA
GTGATTGGCAACTTCAGTGCAACTTGGTGTGGTCCATGCAAATCAATGGCACCTTACTACATTGAGCTATCAGAGAAGTATCCTTCTCTTATGTTT
CTGACCGTAGACGTTGACGAATTAACG
GATTTTAGCACACAACTGGATGTAAAAGCTACTCCAACATTCTTCTTCTTTAAAGATGGTCAACAAATTGATAAACTTGTGGGAGCCAACAAG
CCTGAACTGCAGAAAAAGATAACCGCCATTGTTGATTCACAAGCAACCATAAATCCATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCAACAGTAT ATAATAATAT CATATTATGT AATAAGGTAT CATTTCATCA TCAATCTTCT ACCAAATTTC CAGATCAGTT GCTTTCAACT TTATTAAAAC CCTAATTAGG TGAGGTTTGT  GATTTAGCAG GAGCATCTAA CTTCAATCGT CACCGGAAAC TTCAAATTTC AGGGTAAGCG TACTGCGGTT ACTTTTTAAG AGATTGAAAT GGGGCATTGC TTCTCTTCGC CTCGGGCTGA  TGAAGACGAG ACCAACAGTC ATGCTCAGCT TGCGGGAGGT AACGTGACTC TCATCACTAC CAAGAACGCT TGGGATCAAA AACTGGCAGA AGCAAAGACT CAAGGCAAAA TAGTGATTGG  CAACTTCAGT GCAACTTGGT GTGGTCCATG CAAATCAATG GCACCTTACT ACATTGAGCT ATCAGAGAAG TATCCTTCTC TTATGTTTCT GACCGTAGAC GTTGACGAAT TAACGGATTT  TAGCACACAA CTGGATGTAA AAGCTACTCC AACATTCTTC TTCTTTAAAG ATGGTCAACA AATTGATAAA CTTGTGGGAG CCAACAAGCC TGAACTGCAG AAAAAGATAA CCGCCATTGT  TGATTCACAA GCAACCATAA ATCCATAATC ATTGTTATAT GATGCCTTGT GTTTCATGTT TTATGGGACA ATAGTACTGC ATTTTACCAG ATGAACATAT CTGCTCTATT GAATGTTGTC  TGTGATTCCT ATTAAACGAG TTCTTTTTTG CGCGAACCTG TAGATATATT CTTGACATGA TTTTTGGGTT TGTGTCATAT TCGAATTTGT GTTAAATTTG ACCTGAAACT GTGAATTTAA 
CAACTCCAAA CAATTATATG TTTTATTTTT ACAAAGTTTA CAATGAATTG AACTGAATAA AATATTGGG 

Retrieve as FASTA