Entry information : HaTrxM04HanXRQChr11g0328441
Entry ID 14509
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaTrxM04HanXRQChr11g0328441
Name HaTrxM04HanXRQChr11g0328441
Class Thioredoxin Type M    [Orthogroup: TrxM001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxM04
start..stop
S start..stop
HaTrxM03 280 5e-98 1..185 1..185
HaTrxM01 256 5e-88 1..185 35..212
HaTrxM06 230 2e-78 1..185 1..163
ThasTrxM04-2 201 1e-66 1..185 1..191
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 32892848..32893091 244 N° 2 32896329..32896642 314  
join(32892848..32893091,32896329..32896642)


exon

Literature and cross-references HaTrxM04HanXRQChr11g0328441
DNA ref. HanXRQ genome:   HanXRQChr11 (32892848..32896642)
Protein sequence: HaTrxM04HanXRQChr11g0328441
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   185
PWM (Da):   %s   19964.5  
PI (pH):   %s   9.03
Sequence 226
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALLETLTVPRATGFPAASLTPIASSPLAQLSVRRNSLPESRTSKLKINSFSSSGSVRLRSKFGRRGGRIVCEAQEAPVQVLPVTDGSWQSLVLDSELPVLVEFWAPWCGPCRMIHPIIDELAKEYNGKLACYKVNTDESPSIATNYGIRSIPTVIIFKDGEKKEAVIGAVPKSTLSTCIEKFL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCGCCCTTCTCGAAACCCTAACCGTTCCTCGCGCCACCGGATTCCCCGCGGCTTCTCTAACTCCGATCGCCTCTTCTCCTCTCGCTCAACTCTCCGTTCGCCGGAACTCTCTGCCGG
AATCCAGAACCTCAAAGTTGAAGATCAATTCCTTCAGTTCTTCTGGATCTGTCAGATTGAGGTCGAAGTTCGGCCGTCGTGGCGGACGAATCGTCTGCGAAGCACAGGAAGCACCAGTAC
AAG
GTTAGAATCGTTTTATTGTGTTGTTATTTTATGAAATTTGTGCTAAATTTGATTATATTATGCTTTCTAGACCTTCTGTAGCGAGCAGGTCTCTCGATTCTCGAATAATTGTTTTGA
TTATTGTTTTCTGATTTTTAAATCTATGTTTGTTTGGCGATTGACATTCTAGGACTCTAGCACTAGCCATCACCACTTTGGTGGGTTGGTAGAGGCTTTGTGCCTCTTGCAGACAGACCA
GGGTTCAATTCCTAGCATGGGGTAAAACTTGGTGTAATTTAGGAGTAGTGTTATGTAAGGATTCTAGCACTAATTTGTTGATGTTCTAATACTCGAATACATACACAGACATACAGTGTT
GTAATTGTATAGGAAGAACATGTTCATCTCGATTTGAAGCCACATTTATGTTTTCAGTGAAGTTCATAGTTGTTAATAGCGGCTATAGCGACCGGCCCTAAGCAGTCAATAGCGGTGCTA
TAGCGGTTAGCGGACCTCAGGGTGTGTAGCGGTCCAAATAGCGGTGGCCTATAGCGGTTCCACTATTAGCGGCGCTAAATACCGCTATAGCGGTGCTATAGCGGTACTCTAGCGGTGCTA
TAGCGGTGGCCTATAGCGGTTATAGCAATAACAGTGTTTGATTGTATTAATTCTTAGATAAAATACTTCAAAGTTACTATTAGTATTTGATTTGCAACGGGTTTTTGATAATGGAATGAT
ATTACTATGAATTTTGATATTACTATTAATATTTTTCAAAGATATATTTATATAGGTAGAGGATCCTGTAAAAAGTGCTCAAAGTGTGAGAAGTGTATTGTAACACTATATATAATACTA
TATAACACCGTATAAACACCGTATAACAATATGTAACACCATATAATACCATATAACACTATATAACATTATATAACAAATATAACACTATAGTTTGTCTGATAGCATGTCTATGATAGA
TGTATAGTGTTATATTTGTTATATAATGTTATATAGTGTTACATAGTGTTATATGGTATCATATGGTGTTACATATTGTTATACGGTGTTTATATGGTGTTATATAGTATTATATATAGT
GTTATAATACACTTCTCACACTTTAGGCCCTTTTTACACTATCCTTACCCTATTTATATATATATAAAAATACATAAATTATGCATGGTATAAAAATTACCGCTATATCACCGCTATGCC
ACCGCTATAACCTATATATCATATAGCGGACCTTGACCGCTATTCGATTTTGGACCGCTTTAACTGCATAGGCGACCGCCATAGCGCACTATGTAGCCATGCGACCAAGTGTCGCTATAT
GGGTCTTAGCGATCAATGGCGAACTTAGCGACAGTTAGGTATTTTTTTTTTTTGATGTTAATATCAATTAGATATAGCTATAAAATCGCTGGATTTATAGGTTTTTGTTAAATATACATG
TAAAATAGCATATATACAAGGGTATTTTGATGTAATATACATATAAAAATTTTCAAAATTCTTTTTCTAGTGTAATCGCTATTTATAAAATAGTCGTCGCTATTTGTCGCTATTCGCTAC
GTAGCCTATAGGTGCCTTGTCGCTATTCGCTATCGACAACTATGGTGAAGTTGATATCTGTTTTGTTGGTTAAAACTTAAAATCAATGTAGTTATCATTTTTTCCTCTAAATGCTGAAAC
GTATAGTTTTGGATCTGAATTAAATAGATCGGTTATACTTTACGTACCTATTGTAGCAAACTATGCAGTCAATAGCGCTTAGCGGACATACGAACTCATAGCGGTCCAAATAGCTGTCCA
AATAGCGGTCCCTTATAGCAGTCCCGCTATTAGCGGTGCTAAATTCCGCTATTGGACCGCTATTTTGAAACCCGTATAGCGGTCATAGCACTGCTTTTAGCGGTTTTTCTTATTTCAGCC
CAAAAGTAAGGTAAAGCCCACATTAATTAACTTTTTGTTTATAAATAAACCCAAAAGTAAAGGCCCAAACCCGAAATTAAACCTAAATTGAGACCAAAAGTCTTCATTCGTTGGTTCTTC
ATCAGTTCATCATTCAACAAAATTAAACCTAAATCTCTAAATCGCTGGACTTCCTCAGTTAATGTTTTGAATTTTGATATTACTACTAATATTTTGCATGATAATATGATATTACTATAA
ATTTTGATATTATTATTAATTTTTTTCAGTATATATATTTATATACATATAAATACATAAAATATGCATGATATAAAAATTACCGCTATACCACAGCTATAACTTAGATATCATATAGCG
GACCTTGACTGCTATTTGATTTTGGACCGCTATAACTGCATAGGTAGCGAATAGGTTTTCTGATACTCGTTACGATTATTGTTTTTGGATTTTTGAACCTATTTTTGGTTAGCAATTGAC
ATTCTAGCACTGATTTGTTGGTGTCCTCATACTCGGATACGAATACAGTATTGTAATTGTATGTGAAAAACAAGAACATGCTCATCTCGAATCTTGATTTAAAGTCACATTTATGTTTTC
ACTTTTCAGTGAAAGTGATATCTGTTTTGTTGATAAAAAATCAATGTAGTTATTATTTCATCCCGAATAGGTGAAAACAAACATATAGTTCTGGATCCTGAGTTATAACTCTCTTAGACA
TTTGTTTTTGCTGTTCTTAATTGATGGAATATCTTCGTATCGTGATGAATTTGAGAGTTGGCTAGACAAATTATCAATCAACCGTTAGATTTGATTAGCATTTGTTGTGCTAAAAGGAGC
TAGCATACATGTAGTGGTGTGAATACGCCGAGCCGAGCTAGACTCGTTTTGAGTTCTATTTCTAAAGCTCGAGCTCGTTTATTATTTGTTAATTTCGTTTATTATATATTAGTTACTTTA
TGTACATTTATAATTATAACATTTATATAATAATATGTATTATTTAGTTTTTTTATATATAAATTTTTATGTATAACAATAGTTATCATATAAATATTTATTTAATATACTAAATAAAAG
TTATATAAATAATAGGCTGTATAGGCCCATGAACTAGCTTGAGCTCGATAAGTGAAGCTGGGGCTCGGGCTTGTTTATCAAACAAGCTTATTTTTAGGCTTGAGCTTGTTTTAGCTCAGC
TCAATTCGAGCATTTAATGAGCCGATCTCGAGTAGTCCACGAGCAACTTGGCTTGTTTACACCGCTATTTGTATTTGATGATTGTTGATGACCAACTGAAGTAAATTATTGAGATTGCAG

TACTTCCTGTGACTGATGGTTCATGGCAATCACTTGTTCTGGACTCTGAGCTTCCCGTACTGGTTGAATTTTGGGCTCCGTGGTGCGGGCCATGTCGCATGATCCACCCGATCATTGATG
AGCTGGCGAAAGAATACAACGGCAAGCTCGCTTGTTACAAGGTGAACACTGATGAGAGTCCTTCAATCGCTACCAATTATGGTATAAGAAGCATTCCAACTGTCATTATCTTCAAAGATG
GAGAGAAGAAAGAGGCAGTTATTGGCGCTGTTCCAAAATCTACTCTGTCTACCTGCATTGAAAAGTTTTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCGCCCTTCTCGAAACCCTAACCGTTCCTCGCGCCACCGGATTCCCCGCGGCTTCTCTAACTCCGATCGCCTCTTCTCCTCTCGCTCAACTCTCCGTTCGCCGGAACTCTCTGCCGG
AATCCAGAACCTCAAAGTTGAAGATCAATTCCTTCAGTTCTTCTGGATCTGTCAGATTGAGGTCGAAGTTCGGCCGTCGTGGCGGACGAATCGTCTGCGAAGCACAGGAAGCACCAGTAC
AAG
TACTTCCTGTGACTGATGGTTCATGGCAATCACTTGTTCTGGACTCTGAGCTTCCCGTACTGGTTGAATTTTGGGCTCCGTGGTGCGGGCCATGTCGCATGATCCACCCGATCATTG
ATGAGCTGGCGAAAGAATACAACGGCAAGCTCGCTTGTTACAAGGTGAACACTGATGAGAGTCCTTCAATCGCTACCAATTATGGTATAAGAAGCATTCCAACTGTCATTATCTTCAAAG
ATGGAGAGAAGAAAGAGGCAGTTATTGGCGCTGTTCCAAAATCTACTCTGTCTACCTGCATTGAAAAGTTTTTGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAGATTTGA AAGGTGCCAA GCACGTGACA CCTCATCCAT CCCACAATAA TCTCATCTCA CCAACACACA CCAGCCATTC ACACTCCCAC ACTCCTCCCC TCTCCATTAG TTTGTTAGTT  TTCCGATGGC CGCCCTTCTC GAAACCCTAA CCGTTCCTCG CGCCACCGGA TTCCCCGCGG CTTCTCTAAC TCCGATCGCC TCTTCTCCTC TCGCTCAACT CTCCGTTCGC CGGAACTCTC  TGCCGGAATC CAGAACCTCA AAGTTGAAGA TCAATTCCTT CAGTTCTTCT GGATCTGTCA GATTGAGGTC GAAGTTCGGC CGTCGTGGCG GACGAATCGT CTGCGAAGCA CAGGAAGCAC  CAGTACAAGT ACTTCCTGTG ACTGATGGTT CATGGCAATC ACTTGTTCTG GACTCTGAGC TTCCCGTACT GGTTGAATTT TGGGCTCCGT GGTGCGGGCC ATGTCGCATG ATCCACCCGA  TCATTGATGA GCTGGCGAAA GAATACAACG GCAAGCTCGC TTGTTACAAG GTGAACACTG ATGAGAGTCC TTCAATCGCT ACCAATTATG GTATAAGAAG CATTCCAACT GTCATTATCT  TCAAAGATGG AGAGAAGAAA GAGGCAGTTA TTGGCGCTGT TCCAAAATCT ACTCTGTCTA CCTGCATTGA AAAGTTTTTG TAAGAGGTAC TGTCATCTGT ACATACTAGT TTTCACCAAT  TTACTTCTCT TGTTTGTCTA GTCTATTTTG TCACAAACCA TGATCTTGTT CATTATATAT TATTCTCTCT TTTGTTTTCT TTAAAATCTG GGAAATCGTA CTTTATAGGC AAACCCGGGC  TCTTACTAGT TTACCGAGGT TTAACCATGG TTGCAAAAGT CGCTAGGCGC TTCCTAGTCG GATTCGGGAG TGCTCGGCTT AGGCGGAGAT TACTCGGGGA GTAATTGGTC TGGGAGACCA 
GTACTCGTGC CTCGGCAGCC TACCTTGTAG CGAGTACTCG GGGA 

Retrieve as FASTA