Entry information : HaTrxM06HanXRQChr13g0407021
Entry ID 14511
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaTrxM06HanXRQChr13g0407021
Name HaTrxM06HanXRQChr13g0407021
Class Thioredoxin Type M    [Orthogroup: TrxM001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxM06
start..stop
S start..stop
HaTrxM01 249 8e-86 1..163 35..212
HaTrxM03 246 9e-85 1..163 1..185
HaTrxM04 230 2e-78 1..163 1..185
AtTrxM04 191 4e-63 17..163 38..191
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 113900673..113900850 178 N° 2 113901750..113902063 314  
join(113900673..113900850,113901750..113902063)


exon

Literature and cross-references HaTrxM06HanXRQChr13g0407021
DNA ref. HanXRQ genome:   HanXRQChr13 (113900673..113902063)
Protein sequence: HaTrxM06HanXRQChr13g0407021
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   163 (323)
PWM (Da):   %s   17691.4 (35488.9)  
PI (pH):   %s   9.6 (6.88) Peptide Signal:   %s   cut: 27 range:27-349
Sequence 204
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARVLETLTLPRASAVPATSRNFVNLQASRGLRIQSFGSPKLGRKLSARIVCQAQEAVQVLAVTDATWQKNVLESDVPVLVEFWAPWCGPCRMIHPIIDELAKEYTGKLACYKVNTDESPTIASQYGIRSIPTVIIFKGGEKKDAVIGAVPKSTLSTSIEKFL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTCGTGTTCTTGAAACTCTTACACTTCCCCGGGCCTCTGCCGTCCCAGCGACATCACGGAACTTTGTAAATTTGCAGGCATCAAGAGGTTTGAGAATCCAGTCGTTTGGATCGCCTA
AGTTGGGACGTAAATTAAGCGCACGTATTGTTTGCCAGGCTCAGGAAGCTGTTCAAG
GTTAGAATATTTAATTGTACCATTTATAATTGTCCTAGCTAGATTTCAGTTCATGTATCTGTT
ACGAGACTCATTTAACAGGGGGAGGGGAGGGAAAAGAGATAAAAATATGAAAAACCATGTTCCCGAGTTTCATTTAACAGGGGGAGGGGAGGGAAAAGGGAAGAAAATATGACCAAATAT
GACCATATATTCATCCTCCCAAATTGGAGAGATTAGGAAAGAAAATTTTCCTTCTCCTCCCCTCCCCTCACCTCCCCCTGTTAAATGACTCGGGAACATAGTGGAAATGAAAAGTCTGTT
TATGTTTGAATGGTGGATGAGAGACGTATTGGATCAATGTCTAGTATGGGGTGTTCATCGATTTGGTTTTTGGATTTTATTTAATCATAACTCAAAACCAAGCCGAAGAAAATAAGTGTG
CGAATTCGGCTTGGTTTACTTTTTATCTAAAAGTAATCTTTTAAAAGTAAATTATATTGTAATTTTTATTATAATCCACAAATTTGGTATAATTAATATATTAAGTAACTATTTAGTTAA
GTTTTATATATTTTTTTTTTTTGGAAAATGTCACATAATAGTAACAAAGTTTTAAAAGTGTTTTAATTAGGTCACTCGTATCGTTTTTCTTCCAATTAAATAACTTAACATTCAAATCGA
GTCATGTCCTTTTTCTATGTGTCAAGAAAAAAATAGAGCACAAGATGCTGGAGGCGGATTATTTTAATATATGAAATTATATTTATTAAAAATAAAAACACTTTAATTACATTAAAAACT
AAAAAAACAAGTTACAATAAAAGGGAAAAAAAAAACAAAAATCCAAATCACCACGGTTACCTATGAAATGTATGAATAGTTTTACCAAATTTATAACGCAATTTGCTGTTTTACAGTTCT
TGCAGTCACTGATGCAACATGGCAAAAAAATGTCCTGGAGTCTGATGTCCCTGTACTGGTTGAGTTCTGGGCCCCATGGTGCGGGCCTTGTCGCATGATCCACCCGATCATCGATGAACT
TGCAAAGGAGTACACAGGGAAACTCGCTTGTTACAAGGTGAATACTGATGAAAGCCCCACAATTGCAAGCCAATATGGGATCAGAAGCATCCCCACTGTTATTATATTCAAAGGTGGTGA
GAAGAAAGATGCAGTTATTGGTGCAGTTCCTAAATCTACACTCTCTACCTCCATTGAAAAGTTCTTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTCGTGTTCTTGAAACTCTTACACTTCCCCGGGCCTCTGCCGTCCCAGCGACATCACGGAACTTTGTAAATTTGCAGGCATCAAGAGGTTTGAGAATCCAGTCGTTTGGATCGCCTA
AGTTGGGACGTAAATTAAGCGCACGTATTGTTTGCCAGGCTCAGGAAGCTGTTCAAG
TTCTTGCAGTCACTGATGCAACATGGCAAAAAAATGTCCTGGAGTCTGATGTCCCTGTACTGG
TTGAGTTCTGGGCCCCATGGTGCGGGCCTTGTCGCATGATCCACCCGATCATCGATGAACTTGCAAAGGAGTACACAGGGAAACTCGCTTGTTACAAGGTGAATACTGATGAAAGCCCCA
CAATTGCAAGCCAATATGGGATCAGAAGCATCCCCACTGTTATTATATTCAAAGGTGGTGAGAAGAAAGATGCAGTTATTGGTGCAGTTCCTAAATCTACACTCTCTACCTCCATTGAAA
AGTTCTTGTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTGTGCCAT ATCTAAAGAA GTGGGCCCAG CAATATCAAG GCCCAAACAA ATGTCATCCA ATCCAATCCA AGAAGATAAA CCGTGTGCAA AGCACGTGAT ACCACCACCA ACTAACAATT  AACAAACTCC ATTCAACCCA ATTATCTATT CTGGTTCATC CACACAACAG AAACTCCATT TCTTCTCTTT GTATAGTTAG ATGGCTCGTG TTCTTGAAAC TCTTACACTT CCCCGGGCCT  CTGCCGTCCC AGCGACATCA CGGAACTTTG TAAATTTGCA GGCATCAAGA GGTTTGAGAA TCCAGTCGTT TGGATCGCCT AAGTTGGGAC GTAAATTAAG CGCACGTATT GTTTGCCAGG  CTCAGGAAGC TGTTCAAGTT CTTGCAGTCA CTGATGCAAC ATGGCAAAAA AATGTCCTGG AGTCTGATGT CCCTGTACTG GTTGAGTTCT GGGCCCCATG GTGCGGGCCT TGTCGCATGA  TCCACCCGAT CATCGATGAA CTTGCAAAGG AGTACACAGG GAAACTCGCT TGTTACAAGG TGAATACTGA TGAAAGCCCC ACAATTGCAA GCCAATATGG GATCAGAAGC ATCCCCACTG  TTATTATATT CAAAGGTGGT GAGAAGAAAG ATGCAGTTAT TGGTGCAGTT CCTAAATCTA CACTCTCTAC CTCCATTGAA AAGTTCTTGT AGAGCTCTTG TGGTGTATAT TTATTTATTT 
ATGTATAAAT ACTCTTTAGA TCGATTTGTT CCTATATATA CTACTACTCT TGGATCTTCA TCTTTGAAAT GGTATTAAAT TTTTTTTATG GTATACAA 

Retrieve as FASTA