Entry information : HaTrxY01 (HanXRQChr11g0320301)
Entry ID 14514
Creation 2017-11-03 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaTrxY01 (HanXRQChr11g0320301)
Name (synonym) HaTrxY01 (HanXRQChr11g0320301)
Class Thioredoxin Type Y    [Orthogroup: TrxY002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxY01
start..stop
S start..stop
ThasTrxY01 188 3.73e-62 43..161 51..170
AtTrxY01 184 1.39e-60 56..161 63..168
AtTrxY02 176 2.33e-57 53..161 55..163
ThasTrxY02 170 4.9e-55 16..161 20..168
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14514' 'complement(join(1077030..1077092,1077167..1077344,1077448..1077536,1078423..1078587))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1078423..1078587 163 N° 2 1077448..1077536 87 N° 3 1077167..1077344 176 N° 4 1077030..1077092 61
complement(join(1077030..1077092,1077167..1077344,1077448..1077536,1078423..1078 587))


exon

Literature and cross-references HaTrxY01 (HanXRQChr11g0320301)
DNA ref. HanXRQ genome:   HanXRQChr11 (1078587..1077030)
Protein sequence: HaTrxY01 (HanXRQChr11g0320301)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   164 (304)
PWM (Da):   %s   17904.22 (33276.9)  
PI (pH):   %s   8.31 (9.43) Peptide Signal:   %s   cut: 17 range:17-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVVSIPTWNSALVTSSSISSSKLANLSSLQCQPHLPTPRTALTY
RRSKRSSLPI
VAAKKQTFSSLDDLLEKAEKPVLVDFYATWCGPCQFMGPILNEVSVSMGDSIQVVKIDTEKYPEIANKYSIEALPTFILFKDGKPCDREGAMTANQLIQRIEGTLANP*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGTCGTCTCTATCCCCACATGGAATTCGGCGCTGGTAACTTCATCTTCTATCTCATCGTCGAAGCTTGCCAATCTATCATCCCTGCAATGTCAACCACACCTTCCTACTCCTCGT
ACGGCGCTCACTTATCGTCGAAGCAAGCGTTCATCGCTTCCCATA
GTAATCTCTCTCTCTCTCTTCTTTTTTCATTCATTTGCCTTATGCCATAGGTCTTCTGTCTTTAATTAGCATTTC
AACTGAAACCAAATTACTATCCGTCCGTACAATTAGCTAGGTTTCTGATTTTATTCATCTCCACAACTTAACTTAAACAGGTGGTCGTGGGTTGGCTCTACTTGAAACAATATACCCATA
GTGTGTGTGTGCAAACTTCTTCTTCTTCTTATGATTTATATAAGTAGTATTAAACATTTTCTTATTAAATGGGATTAGGTTAAGAGATGATCAATCAACATGTGCAGTGTTTTGGGATAA
TTCAGTATCTATTAACATAGCTTATACTTACTCTCTAATATTTGTCACTTATAGATACGTTAGGGAATTTGATTTCATTTCATTTCAAGTGACAAAAAACACAAACTGCAACCTCTATGC
TGTGCACAGAAGAATGATTAGTTTGATAAGGTTTTGGATGCAATAGAAAGGAATTAGGCGTTATTGTAAGTAACTTGATGATGATTGTCCTACAAGGTTTGTAAGTACAAACAAGGATCA
GATTATTATAAGTCAGCCTACAATAGATACACAAGATGTTATGTATGCTTTTCACAGATACTAATGCCAAACAACGTGTTATCGCAAAGTTGGAGGCTAGAAGAAGCACTTTTGGTTTCA
TTTCTAGCCTACTCCAGGGGTACAACGACTTTTGTTGTATGAAAGTAGAACACAAATAATGGACATTGTTGGCATCACTTAGTGGAAAAATGAAAATTTGAGACTTGATGACAATGAATG
CCTTCATGCTTTTCTGTGACTGGTTGTTGTCTAATTTAATTATCTTTTTAAAGAAAAAAAAATACTAACTTGCTGAGTGATGACGTGTCAGGTGTTGCAGCAAAGAAGCAAACATTTTCG
TCCCTGGATGATTTACTTGAAAAGGCTGAGAAGCCTGTGTTGGTTGACTTTTATGCAACCTG
GTAAACAACTCTGTATGCTGGCACATTGTGACAATGAAGTTATATTTGTCTTAGGTTG
AAAATGAAGGGATGTATGTGTATTAATATTATATATCACTTGCAGGTGTGTGGCCCATGTCAGTTTATGGGTCCTATACTTAACGAAGTTAGTGTTAGCATGGGAGATAGTATCCAAGTG
GTGAAGATTGACACTGAGAAATATCCTGAAATTGCAAACAAGTACAGCATCGAGGCCTTGCCAACTTTCATCCTGTTCAAGGATGGAAAGCCTTGCGACCGTTTT
GTAAGTTTGACTTCG
GGCATTATGTCATATGTCAAAACAATAACAAATTGACTGTTATATTATATTGGTTTCAGGAGAAGGAGCTATGACAGCAAACCAGCTGATCCAGCGAATCGAGGGTACCCTGGCTAACCC
TTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGTCGTCTCTATCCCCACATGGAATTCGGCGCTGGTAACTTCATCTTCTATCTCATCGTCGAAGCTTGCCAATCTATCATCCCTGCAATGTCAACCACACCTTCCTACTCCTCGT
ACGGCGCTCACTTATCGTCGAAGCAAGCGTTCATCGCTTCCCATA
GTTGCAGCAAAGAAGCAAACATTTTCGTCCCTGGATGATTTACTTGAAAAGGCTGAGAAGCCTGTGTTGGTTGAC
TTTTATGCAACCTG
GTGTGGCCCATGTCAGTTTATGGGTCCTATACTTAACGAAGTTAGTGTTAGCATGGGAGATAGTATCCAAGTGGTGAAGATTGACACTGAGAAATATCCTGAAATT
GCAAACAAGTACAGCATCGAGGCCTTGCCAACTTTCATCCTGTTCAAGGATGGAAAGCCTTGCGACCGTTTT
GAAGGAGCTATGACAGCAAACCAGCTGATCCAGCGAATCGAGGGTACC
CTGGCTAACCCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGGACTTGA AAAAAAATAG AATCTTCCCA GCCCAGCCAA ACACACCAAC CCAACACAAG GCTGCAGTTT CCCACAAGCA AAGCAATAGA TTGATTGATT ATATTTCATA TCATATCGTT  TGTCTCATAG ACATCTCCAT CCGATGGCCG TCGTCTCTAT CCCCACATGG AATTCGGCGC TGGTAACTTC ATCTTCTATC TCATCGTCGA AGCTTGCCAA TCTATCATCC CTGCAATGTC  AACCACACCT TCCTACTCCT CGTACGGCGC TCACTTATCG TCGAAGCAAG CGTTCATCGC TTCCCATAGT TGCAGCAAAG AAGCAAACAT TTTCGTCCCT GGATGATTTA CTTGAAAAGG  CTGAGAAGCC TGTGTTGGTT GACTTTTATG CAACCTGGTG TGGCCCATGT CAGTTTATGG GTCCTATACT TAACGAAGTT AGTGTTAGCA TGGGAGATAG TATCCAAGTG GTGAAGATTG  ACACTGAGAA ATATCCTGAA ATTGCAAACA AGTACAGCAT CGAGGCCTTG CCAACTTTCA TCCTGTTCAA GGATGGAAAG CCTTGCGACC GTTTTGAAGG AGCTATGACA GCAAACCAGC  TGATCCAGCG AATCGAGGGT ACCCTGGCTA ACCCTTAACA AAGAGTTTTC AGTACATTTT CATTTTAAAA GTGCTACTTT GTTACTTGCA TTGACCTAGC AATTCAACAT TGTGTATTAC  TGTTATTTTT CAACTCCATT CCTGGTTAAT AGTAAGTCTC ATTTTACATT ATTAATATGT ATTGATCATT GTAACATATT TATAAATACG CGTGGCAAGA CTTTCTTTTC TTTTAGAATT 
GAGTTTATCT CATAAAATTA AT 

Retrieve as FASTA