Entry information : HaSTC33HanXRQChr17g0561421
Entry ID 14608
Creation 2017-11-07 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaSTC33HanXRQChr17g0561421
Name HaSTC33HanXRQChr17g0561421
Class Stellacyanin    [Orthogroup: STC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaSTC33
start..stop
S start..stop
HaSTC31 467 3e-169 1..261 1..263
HaSTC35 466 7e-169 1..261 1..263
HaSTC34 465 1e-168 1..261 1..263
HaSTC32 461 5e-167 1..261 1..263
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 158893549..158893717 169 N° 2 158893820..158894173 354 N° 3 158894259..158894521 263  
join(158893549..158893717,158893820..158894173,158894259..158894521)


exon

Literature and cross-references HaSTC33HanXRQChr17g0561421
DNA ref. HanXRQ genome:   HanXRQChr17 (158893549..158894521)
Protein sequence: HaSTC33HanXRQChr17g0561421
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   261 (237)
PWM (Da):   %s   28862.85 (26458.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.55 (9.45) Peptide Signal:   %s   cut: 25 range:25-261
Sequence 302
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATNKWGVIFVTATIAALATSVSAKLFTVGDEKGWTLNFDYQAWAKDKVFVVGDQLVFKYATGKHNVFRVNGTVFQQCIIPPTNEALTSGYDVITLATPGRKWYICGVGKHCEYGLKLFINVLSQSYPSPPPPPSVYPAPSGKVFVVGDDKGWTLNFDYQAWAMGKKFYVGDKLVFRYPKGIHNVFRVDGTSFQQCIIPAAYEALTSGYDVITLQTPGRKWYICGVGKHCQMGLKLFINVLPYPTYVPPPYHGTRKLAPPS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTACTAACAAGTGGGGCGTCATCTTTGTCACAGCAACAATAGCAGCTTTAGCTACTTCAGTTTCGGCCAAGTTGTTTACTGTTGGTGACGAGAAAGGATGGACACTCAACTTCGATT
ATCAAGCTTGGGCCAAAGACAAGGTATTCGTTGTTGGAGATCAACTCG
GTATGTGTCCTTTTACAATATGAGCATTATGTACTTCTGTACGATGGGTACTCGTGTTAGTAGGTGTTTATA
TAATAAATTCTGTATGCGTTATGTGTGTAGTTTTCAAATACGCTACTGGAAAACACAATGTCTTCAGAGTCAACGGAACTGTTTTCCAACAGTGCATCATTCCTCCTACAAATGAAGCTC
TTACTAGTGGATATGACGTGATAACACTAGCAACTCCAGGAAGAAAATGGTACATATGTGGAGTTGGCAAGCACTGTGAGTATGGTTTGAAGCTTTTCATCAACGTGCTTTCACAATCAT
ATCCTTCACCTCCACCTCCTCCATCGGTTTATCCAGCTCCTTCAGGCAAAGTGTTTGTGGTTGGAGATGATAAAGGCTGGACCCTGAACTTTGATTACCAAGCTTGGGCCATGGGAAAGA
AATTCTATGTCGGAGATAAGCTTG
GTGCGTATTTATACGCCATCCAATATTTGTGTGAATCGAATGTTTTGATGCAGATTGCTAACTGGTTACAACTTTATTGTCACAGTTTTCAGGTAC
CCAAAGGGAATACATAATGTATTTAGAGTAGATGGAACTTCATTCCAGCAATGTATCATTCCTGCTGCTTATGAAGCCCTCACCAGTGGATACGACGTGATCACTTTACAAACCCCGGGG
AGGAAATGGTACATTTGTGGTGTTGGAAAACACTGCCAGATGGGGTTGAAGCTTTTCATCAACGTACTTCCCTATCCAACATATGTACCTCCTCCATACCATGGAACAAGAAAACTCGCA
CCACCTAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTACTAACAAGTGGGGCGTCATCTTTGTCACAGCAACAATAGCAGCTTTAGCTACTTCAGTTTCGGCCAAGTTGTTTACTGTTGGTGACGAGAAAGGATGGACACTCAACTTCGATT
ATCAAGCTTGGGCCAAAGACAAGGTATTCGTTGTTGGAGATCAACTCG
TTTTCAAATACGCTACTGGAAAACACAATGTCTTCAGAGTCAACGGAACTGTTTTCCAACAGTGCATCATTC
CTCCTACAAATGAAGCTCTTACTAGTGGATATGACGTGATAACACTAGCAACTCCAGGAAGAAAATGGTACATATGTGGAGTTGGCAAGCACTGTGAGTATGGTTTGAAGCTTTTCATCA
ACGTGCTTTCACAATCATATCCTTCACCTCCACCTCCTCCATCGGTTTATCCAGCTCCTTCAGGCAAAGTGTTTGTGGTTGGAGATGATAAAGGCTGGACCCTGAACTTTGATTACCAAG
CTTGGGCCATGGGAAAGAAATTCTATGTCGGAGATAAGCTTG
TTTTCAGGTACCCAAAGGGAATACATAATGTATTTAGAGTAGATGGAACTTCATTCCAGCAATGTATCATTCCTGCTG
CTTATGAAGCCCTCACCAGTGGATACGACGTGATCACTTTACAAACCCCGGGGAGGAAATGGTACATTTGTGGTGTTGGAAAACACTGCCAGATGGGGTTGAAGCTTTTCATCAACGTAC
TTCCCTATCCAACATATGTACCTCCTCCATACCATGGAACAAGAAAACTCGCACCACCTAGCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTA ACAAGTGGGG CGTCATCTTT GTCACAGCAA CAATAGCAGC TTTAGCTACT TCAGTTTCGG CCAAGTTGTT TACTGTTGGT GACGAGAAAG GATGGACACT CAACTTCGAT  TATCAAGCTT GGGCCAAAGA CAAGGTATTC GTTGTTGGAG ATCAACTCGT TTTCAAATAC GCTACTGGAA AACACAATGT CTTCAGAGTC AACGGAACTG TTTTCCAACA GTGCATCATT  CCTCCTACAA ATGAAGCTCT TACTAGTGGA TATGACGTGA TAACACTAGC AACTCCAGGA AGAAAATGGT ACATATGTGG AGTTGGCAAG CACTGTGAGT ATGGTTTGAA GCTTTTCATC  AACGTGCTTT CACAATCATA TCCTTCACCT CCACCTCCTC CATCGGTTTA TCCAGCTCCT TCAGGCAAAG TGTTTGTGGT TGGAGATGAT AAAGGCTGGA CCCTGAACTT TGATTACCAA  GCTTGGGCCA TGGGAAAGAA ATTCTATGTC GGAGATAAGC TTGTTTTCAG GTACCCAAAG GGAATACATA ATGTATTTAG AGTAGATGGA ACTTCATTCC AGCAATGTAT CATTCCTGCT  GCTTATGAAG CCCTCACCAG TGGATACGAC GTGATCACTT TACAAACCCC GGGGAGGAAA TGGTACATTT GTGGTGTTGG AAAACACTGC CAGATGGGGT TGAAGCTTTT CATCAACGTA 
CTTCCCTATC CAACATATGT ACCTCCTCCA TACCATGGAA CAAGAAAACT CGCACCACCT AGCTAA 

Retrieve as FASTA