Entry information : HaPrx05 (HanXRQChr17g0543531)
Entry ID 1475
Creation 2005-07-12 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx05 (HanXRQChr17g0543531)
Name (synonym) HaPrx05 (HanXRQChr17g0543531)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx05
start..stop
S start..stop
HaPrx123 651 0 1..324 1..324
LsaPrx31 591 0 1..324 1..325
LvPrx31 588 0 1..322 1..323
HaPrx108 569 0 1..324 1..324
Gene structure Fichier Exons


exon

Literature and cross-references HaPrx05 (HanXRQChr17g0543531)
Literature Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L., Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison ,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project Unpublished (2002). Genoplante
DNA ref. HanXRQ genome:   HanXRQChr17 (34714979..34711757)
EST ref. GenBank:   DY922862.1 [5' end]
Cluster/Prediction ref. HanXRQ:   HanXRQChr17g0543531
Protein sequence: HaPrx05 (HanXRQChr17g0543531)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (305)
PWM (Da):   %s   35465.96 (33144.7)  
PI (pH):   %s   6.65 (6.03) Peptide Signal:   %s   cut: 20 range:20-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKGFCWILVFLVVLRWVQCDLQMGYYGSSCPKAEKIVQDYVNEHI
PNAPSLAAALIRMHFHDCFVK
GCDASILLNVTSSSGNQTEKVAIPNQTVRGFDFIDRLKSLVEAECPGIVSCADIIALAARDSIAITGGPSWKVPTGRRDGLLSNASEALNQIPAPFDNITILIQKFANKSLDLKDLVLLSGAHTIGIAHCPSVSNRLYNFTGVGDRDPSLDSEYADNLRATKCRTQNDTTTILEMDPGSRKTFDLSYYTLLLKRRGLFESDSALTTNSNTLAYINQLLQGSLQNFFSEFALSMEKMGQIE
VKTGTSGEIRRNCAVVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
CDS
Send to BLAST