Entry information : HaPrx06 (HanXRQChr05g0129531)
Entry ID 1476
Creation 2006-09-15 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx06 (HanXRQChr05g0129531)
Name (synonym) HaPrx06 (HanXRQChr05g0129531)
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx06
start..stop
S start..stop
HargPrx01 666 0 1..328 1..328
HpPrx01-1 652 0 1..328 1..331
HaPrx07 652 0 1..328 1..331
SrPrx01 647 0 1..328 1..328
Gene structure Fichier Exons


exon

Literature and cross-references HaPrx06 (HanXRQChr05g0129531)
Literature REFERENCE 1 Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L., Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison ,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project Unpublished (2002). Genoplante.
REFERENCE 2 Fernandez,P., et al., Differential representation of sunflower ESTs in enriched organ-specific cDNA libraries Unpublished (2002)
DNA ref. HanXRQ genome:   HanXRQChr05 (2360862..2358945)
EST ref. GenBank:   DY918683.1 [5' end]  BQ971433.1 [3' end]
Cluster/Prediction ref. HanXRQ:   HanXRQChr05g0129531 UniGene:   Han.2369
Protein sequence: HaPrx06 (HanXRQChr05g0129531)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (307)
PWM (Da):   %s   36882.15 (34575.8)  
PI (pH):   %s   8.7 (8.55) Peptide Signal:   %s   cut: 22 range:22-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPKALIFLALFSLLAIVSVADTDSDSGLVLNFYKDSCPQAEDIIREQVGLLYKRHKNTAFSWLRNIFHDCAVESCDASLLLDSTRRVLSEKETDRSFGLRNFRYLETIKEALERECPGV
VSCADILVLSGRDGIVALGGPYIPLKTGRRDGRRSRADILEQYLPDHNESMTVVLERFKSIGIDTPGVVALLGSHSVGRTHCVKLVHRLYPAVDPALDPGHVEHMLHKCPDAIPDPKAVQ
YVRNDRGTPMKLDNNYYRNILDNKGLLIVDHQLANDKRTKPYVKKMAKSQDYFFKHFGRAITILTENNPLTGTKGEIRKQCNVANKHH*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 23 ESTs.
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST