Entry information : HaPrx35 ( HanXRQChr10g0278591)
Entry ID 1477
Creation 2007-09-06 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx35 ( HanXRQChr10g0278591)
Name (synonym) HaPrx35 ( HanXRQChr10g0278591)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type Flower buds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx35
start..stop
S start..stop
CcarPrx01 596 0 7..355 6..353
CcarPrx02 595 0 7..355 6..353
LsaPrx04 528 0 25..311 1..287
NtPrx15-1A 501 8.34e-180 10..335 7..332
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '1477' 'complement(join(5123656..5124276,5124530..5124724,5128790..5129041))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5128790..5129041 250 N° 2 5124530..5124724 193 N° 3 5123656..5124276 619  
complement(join(5123656..5124276,5124530..5124724,5128790..5129041))


exon

Literature and cross-references HaPrx35 ( HanXRQChr10g0278591)
Literature Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L., Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison ,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project Unpublished (2002). Genoplante.
DNA ref. HanXRQ genome:   HanXRQChr10 (5129041..5123656)
EST ref. GenBank:   DY918041.1 [5' end]
Cluster/Prediction ref. HanXRQ:   HanXRQChr10g0278591 UniGene:   Han.4927
Protein sequence: HaPrx35 ( HanXRQChr10g0278591)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   355 (325)
PWM (Da):   %s   38993.37 (35558.6)  
PI (pH):   %s   7.94 (7.72) Peptide Signal:   %s   cut: 31 range:31-355
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFMAFFFKASSIPTLIFLLLSCNLIRISETQTPAPAPGLSYDFYR
TRCPRLETIIRQNLQSVFASDIGQAAGLLRLHFHDCFVQ
GCDGSVLLDGSASGPSEKDAPPNLSLRAQAFVIIENLRRLVHNACNRTVSCSDITALAARDAVFLSGGPNYSIPLGRRDGLTFATRNVTLANLPPPSANTTTLLNSLGQKGFTPTDVVAL
SGGHTIGIAHCTSFTGRLYPTRDPTMDQTFFNNLRTTCPTTNSTNTTFMDIRSPNVFDNRYYVDLMNRQGLFTSDQDLYTDSRTRSIVTNFAVNQTLFYQNFVNAMIKMGQLSVLTGTQG
EIRSNCSRRNSNDLFMFPDMESDQDGKLASY*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 7 ESTs. Strain="ANN1312".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCATGGCTTTCTTCTTCAAAGCTTCAAGCATACCAACACTAATCTTTCTATTATTATCATGTAACCTGATCCGAATATCCGAAACTCAAACGCCAGCGCCTGCACCGGGCCTGTCG
TACGATTTCTACCGGACTAGATGCCCTCGGCTTGAAACGATTATACGACAAAACCTTCAATCGGTTTTCGCTTCGGATATTGGCCAGGCTGCTGGTTTGCTTCGACTTCACTTCCATGAT
TGCTTTGTTCAA
GTACGTTTGTTTTTGTTGTTTTATTTTATTAAATATGACAATATTTTTAGAATATAATATATAATACATATTGTTATTAAGGATTCTGATTTTCTAAAGTTATCTGGG
GCATTAAATGTGAGAAGTTGAGATCTACTTTAGAAGTAGTCTTAGGGGCTGTTTGATAGCCTCTGAATGGTCATTAAGAGGCTACCTCTTAATGGAACCATTAAGAATTTTACCAATGAG
AAGATAGAAGAATGTGACATGTGATTATTTACCATTCAGATGTTACCTCTTAACCATTCAGACTTGAGGTGACCTCTTATTCATTCAGAGGTTTTAAACTATTAAGAGGTAGTATCTGAA
TGGTCATTAAGAGGCTACCAAACAGCCCCTTATATATTTTTTTTAAACCGGGTCGGATGTTGGATCGGCCAGTAGATCAGTGAACTGGCTACAAAATCGGTCTTGTCGAGTTTGTTTAAA
CTTTCTCTATTTGAGTAGGCCAGTTACTGGTCGATTAAGTTAAATCGAGTGGTCGGACTAGATTTCAATACTTTTTCTATTTTTTTTTTTACATTTAAAAATTTCATTTCTTGATTTCTT
CATTAATTACTTTATTTAGTACAATATTTTTATAATAATTTAGGTTTTATAACTTATTAATATATCTTTTAAACTAGGTATATATAATGTTAACTTTAAATTATTTATGATGTTATCCTG
TTTTTAAAACGGGTATAAGTGATTCAATTACTGGTCCGTTTACAAAAACATTATTAAAAAAATATTTTTCTAATCATTGGATAATTCCATACTTTCCATAATTGGTGTTACGTCCAATTC
GAAGTAGCCTCAGTTTGACTATTTATTAGATTTTTTTCTAATTTTGTACTCCCTTTCTCCGTTAACCTTTTCTTATATTAATTTGAATTAAAGAGCTTGTTTAAACTGTGTGTAAAGAAA
TTTCCATATAATATCTATTGTATAATTGATATTAGCTGTTTAGCAAACAAATTATGATATTAGTTATAACAACCATAAACCTGTCATTACCAGAAAATTAGGAAGCAATTAGTATCAAGT
AATATTTGTGAACAGTAATTTATGTTAATATGTTTATTTAGGTAATAAGATAGACAAATTGTTATTAGAACTATACTATTTTTCAAGAGTAATGCATATGTATCTAAAACAGTAAAACGA
GCTCAAGTTTATATTGGGTCTCATCTAATAAACGAGTTTGAGCCAGAGTTTCAAAGATCAAGCTTGGGTAGGATGTCAAGACGAGATGAGCTTAAACGGGCCTATTATTTAATACATTAA
ATAAATATTTTACATTAAAAACATAAATAACGTGTATTATGTTATATGTGAAATTTATAATTATATATATTGATACAAACAGCGGCGGACCCAAGAATTTTTCTATGGGGGTGCGAAACA
TTTTAAAAATTTTAGGCCCTTAGGTATATAAATAAAAAAATCGGTTCGGGTCGGGTCATGTAAAACAAAAGAAATTGCGACATAACGTCCCTACTCATGGTTCCTATCACAAACAAATTG
ATGCATAAGTTCATCGCTCCATAACATAATGTTTCAATTTTAGTTTTCAACCCTAGAAATCGTGTAATCACCCTAAAAATCATCTAAACAACATAATCACCCTAAAAATCATCTAAACAA
CCATAAACAACGTCAAAACACATGAAATTTCAAACCTATTTAAGAATTTTGTTACCCTTTGGTGTCGGACGGCGGTGGTTCGGGGCTGCTGATGACGTGCTGTTGTGGTTGCTGTTGTGT
TCGATGATCGCTGGTAGGAGACGACCCAAGAGAGGGAGGGCGGGAGGACTTCTAAGGGACTATTGAGTTTATTTTAATTATTATAGTTTGAAGTTAGGTTGAGTTTGGTTAATGGGCTAG
TAATTAGTGGACTATTTATGTTTAATGAAATAGTGGGTTAAGGTATTGGGTATTTGGGTTAAGTTGGGTAATATAAGTTTATATAATTTAGGTAGTTTTTTTAATTAGAGTTTACTAAAA
AAATTAAAATATAAATCGAAAACATTTTTTACCTAAGGTGTGCCGACGAAAAATTCCAAGGGGTGCGGATGAAAAAATTCAAGGGGTGGGGACGAAAAAATCCAAGGGGTGCAGACGGGA
TTTTCAACGGAAAATAGCACTAAATTTTTTTTTTCCCGGGGGTGCGCCCGCCCACCTTAGGCTACATGTAAGTCCGCCCCTGGATACAAATTCAATTATTAGTAAAATGTTTACAACTTT
ACATAATCGGACCAAACCAGGCTGAAGTTTAAGAAAACATTCACATGTCGAGTGCTCTAACGAGCCAAGCTTGAGGACCTGAGATCCAACTTTCTTAAGTTAAACGATGGAGTTGTACTC
GAGCTTACTCAAGCTTTAGTTCGACTTGACAACCCTGATATAAATGATCTATGAGGGTGAAGACCGTGGACGTTAACATATGAGAGCATAAGCTATGGATATAAATTTATGGAGAAATGA
TCTATTCTTTTAACAGCTAAATTTTATTAAAAACATAAAAAACTGATATTGGTTAAGAGAAATAACCAATATCAAAACGAAAAACAAGTACATGAAAACAAATGGATTTCTAAGCCACTC
GTCCCACCAGATTTCCAGTTTACTATCTTTATATCAATGTGGGACTAACCCACTTAGTAGAGACGTATGTCTCTTAAAGAGGATGCCACAATTCATACCAGGGCAAATAAGTATTTTAAT
ATTTTTGGTGTAAATTAGAATAGAAGTAGCATTTTCCGTTCAAACAAAATCTCCATACACAATCCACTCATTGGAACGAAAAATGAAAAATGGCATAAAAAATCAACTCATTCTTTATGG
AGAAAGGATCTATTAGAGTGATGAAGACTTTTAGTGAAGACTAGACATTAATGTATGAGAGTGTAGGTTATTGGCTTTAGAGGACATCTAATTAATATATATATTGATGGTATTTTCTTA
TGAATTATTACTATTTTCATTTTCTTATGAATTATTATTACTTTCATAAAAAAACATATATACTAATACCATAATAAGTTGTTTGATCTAGTATTAAGCTTGTTAATACTTGATACTACA
TTTATTAATATTTGCAAGATTTATTTTTCTTTTTTATTTATAGAAAACACTTCCAACCATTATGAACTTAGATCTTTTCGTAAGAGATTGGTGGTTGAGATGATGAGATGTGGAGGTACG
TGACTATGTGTTACATTTTATTAACTTGAAAAGTCACGACTTGACCCGTCGTAATAATAGTTGATACATAATATAAGTATGAATGATTGATTGTATGATATATCGTATATGAGTGTAGGA
TCGTGAGTTTAATGTTAGGGACATTATCGCATGATTGTATTGTTCTTTTTTGGTGTCAAATGCTCCCCCCCCCCCTCCCCCCTATTTCTATTTGGTTTAACAGGAAGTTAAAAAATATTT
ATAAGATCGTTTCAAAAGCTTGTGGGGCTTCCTCTATAGATCTTGTTTAAAACCGTCCTGATGTAAGCGACCCAAACTCGTGCCATGAATAAGCTCGTTCATTTGGTTTGGTTTGTTTAA
GCTAAACCCTAAATTTTAACGTATATTATAACGGGAATTTTAATCTATATAAGTTTTAAAAAATATTGTAGTTCATAAATTATGTCTTATATGTATGTTAAAATATTATTATATATGTGT
ATGTTTGTCTAAAAAAAATAAACGAGCTGATTCGAGGTTTTTATGAGTCTAGTTGAGCTAGCTAGCTCGTTTAACTTCGAGCATGGGCCCAATCTACTAATCTAGCTCAGCTCCACTCGG
TCATTTACAACCCTATAAAATGCATATCATATCTTATTTTATTTTTTCTGTTCTGATTTTCATACATATATAACAATGCTAGGTGAATACAAAAGAGGTTTAATCTCTAAGAATAATATA
ATATAGGTGTAAAAACATTTTATTGGAATATTTATGGAAATGTTTTTGTATCCGTACAGTGTTTTCCAACAGTTGATATAGTTAACAATTTTTTTTTCTTTTTTGTAATTATGTTAGGGG
GTTGTGATGGTTCGGTGTTGTTGGATGGTTCAGCTAGCGGACCAAGTGAAAAGGATGCACCACCAAACTTGAGTTTGAGAGCACAAGCATTCGTGATCATCGAAAATCTTCGTAGGCTTG
TTCACAATGCTTGTAACCGCACGGTCTCATGTTCTGATATTACTGCTCTTGCTGCTCGTGATGCGGTATTCCTA
GTAAGATCTTTAACCCCTAACATCAAACAGTGGTAAAACTTTAACT
TTTTTATTACGACCACTTTTCGAATATGATCACTTGTTGAATATTACACATATAAAAAATATATGATACACTGATACTAGATGCCAAGGGTCACTTGACCCCTGGTACCTAGGTCTGCCC
TAAATATCAACTTTATCGATGTTGCATACATATAAAGTGGCAACAAATAAACCGAACTAATGATTTACTAACTTGTTGATGATGTAGTCTCGGGCGGTCCTAACTATAGTATACCCTTGG
GAAGACGTGACGGGCTTACCTTCGCTACAAGAAACGTCACACTAGCCAATCTTCCTCCACCCTCCGCAAACACGACTACCTTATTGAACTCCCTTGGCCAAAAAGGGTTCACTCCCACCG
ATGTAGTAGCACTCTCTGGCGGCCACACTATTGGGATAGCCCATTGCACCTCATTCACCGGTCGGCTATACCCAACCCGAGATCCAACCATGGACCAAACCTTTTTCAACAATCTAAGAA
CAACATGCCCCACAACAAACTCTACAAACACCACTTTCATGGACATTCGGTCCCCCAACGTGTTTGACAATAGGTATTATGTTGACCTCATGAACCGTCAAGGACTATTCACCTCAGACC
AGGACTTGTACACGGATAGCAGGACTCGAAGCATTGTCACAAACTTTGCCGTTAACCAAACGTTGTTTTACCAAAACTTTGTGAATGCAATGATAAAGATGGGGCAATTGAGCGTGTTGA
CCGGCACGCAAGGGGAGATACGTTCAAATTGCTCTCGTAGAAACTCAAACGACTTGTTCATGTTTCCCGACATGGAAAGCGATCAAGACGGGAAGTTGGCATCGTATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCATGGCTTTCTTCTTCAAAGCTTCAAGCATACCAACACTAATCTTTCTATTATTATCATGTAACCTGATCCGAATATCCGAAACTCAAACGCCAGCGCCTGCACCGGGCCTGTCG
TACGATTTCTACCGGACTAGATGCCCTCGGCTTGAAACGATTATACGACAAAACCTTCAATCGGTTTTCGCTTCGGATATTGGCCAGGCTGCTGGTTTGCTTCGACTTCACTTCCATGAT
TGCTTTGTTCAA
GGTTGTGATGGTTCGGTGTTGTTGGATGGTTCAGCTAGCGGACCAAGTGAAAAGGATGCACCACCAAACTTGAGTTTGAGAGCACAAGCATTCGTGATCATCGAAAAT
CTTCGTAGGCTTGTTCACAATGCTTGTAACCGCACGGTCTCATGTTCTGATATTACTGCTCTTGCTGCTCGTGATGCGGTATTCCTA
TCGGGCGGTCCTAACTATAGTATACCCTTGGGA
AGACGTGACGGGCTTACCTTCGCTACAAGAAACGTCACACTAGCCAATCTTCCTCCACCCTCCGCAAACACGACTACCTTATTGAACTCCCTTGGCCAAAAAGGGTTCACTCCCACCGAT
GTAGTAGCACTCTCTGGCGGCCACACTATTGGGATAGCCCATTGCACCTCATTCACCGGTCGGCTATACCCAACCCGAGATCCAACCATGGACCAAACCTTTTTCAACAATCTAAGAACA
ACATGCCCCACAACAAACTCTACAAACACCACTTTCATGGACATTCGGTCCCCCAACGTGTTTGACAATAGGTATTATGTTGACCTCATGAACCGTCAAGGACTATTCACCTCAGACCAG
GACTTGTACACGGATAGCAGGACTCGAAGCATTGTCACAAACTTTGCCGTTAACCAAACGTTGTTTTACCAAAACTTTGTGAATGCAATGATAAAGATGGGGCAATTGAGCGTGTTGACC
GGCACGCAAGGGGAGATACGTTCAAATTGCTCTCGTAGAAACTCAAACGACTTGTTCATGTTTCCCGACATGGAAAGCGATCAAGACGGGAAGTTGGCATCGTATTAG

Retrieve as FASTA