1. Browse the Database
  2. View Redoxidase
Entry information : HaPrx38 (HanXRQChr01g0012571)
Entry ID 1483
Creation 2005-08-11 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx38 (HanXRQChr01g0012571)
Name (synonym) HaPrx38 (HanXRQChr01g0012571)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type Protoplasts
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx38
start..stop		 S start..stop
LvPrx34 509 0 25..345 4..322
HaPrx17 502 0 23..344 1..322
HargPrx06 499 1.37e-179 23..344 1..322
LperPrx34 456 4.28e-163 26..316 6..296
Gene structure Fichier Exons►


exon

Literature and cross-references HaPrx38 (HanXRQChr01g0012571)
Literature Tamborindeguy,C., Ben,C., Liboz,T. and Gentzbittel,L. Sequence evaluation of four specific cDNA libraries for developmental genomics of sunflower
Mol. Genet. Genomics 271 (3), 367-375 (2004)
DNA ref. HanXRQ genome:   HanXRQChr01 (77432691..77436859)
Cluster/Prediction ref. HanXRQ:   HanXRQChr01g0012571
Protein sequence: HaPrx38 (HanXRQChr01g0012571)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345
PWM (Da):   %s   37105.65 Transmb domain:   %s   o24-46i
PI (pH):   %s   8.71
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLYINGNLSFFKHSLLTHSDKMAASTTIAFALIACTLCFMSGTSLARLTPNFYSKTCPQVFEVVGSVVRAAVSRERRMGASLLRLHFHDCFVNGCDASILLDDTPTFRGEKTAAPNNNS
VRGFDVIDMIKSNVERVCPGVVSCADILAITALKSVVALGGPTWEVKLGRRDSKTASFSAANGGAIPSPQSSLTNLINTFRAVGLSAHDMVALSGAHTIGQARCTSFRAHVYNDSNIDSL
FAILRQSNCPRSPGSGDNNLAPLDISTPTRFDNHYYKNLIMHQGLLHSDQQLLSGGFTGSLVERYSVNPMSFRVDFAAAMVNMGDIRPLTGANGEIRKNCRVVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST