Entry information : CsorAPx05
Entry ID 15188
Creation 2018-04-27 (Christophe Dunand)
Last sequence changes 2018-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2018-04-27 (Christophe Dunand)
Peroxidase information: CsorAPx05
Name CsorAPx05
Class Ascorbate peroxidase    [Orthogroup: APx2009]
Taxonomy Eukaryota Viridiplantae Chlorophyta Trebouxiophyceae Chlorellaceae Chlorella
Organism Chlorella sorokiniana    [TaxId: 3076 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsorAPx05
start..stop
S start..stop
CsorAPx02 288 9.13e-92 66..341 432..707
CsorAPx03 187 1.06e-56 44..334 46..351
CsorAPx04 157 1.52e-45 19..334 17..339
KflAPx-R02 110 5.2e-28 105..324 90..299
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '15188' 'join(587409..587567,587724..587797,587968..588083,588336..588388,588557..588625,588853..588894,589098..589202,589460..589476,589639..589712,589945..590055,590241..590317,590522..590578,590844..590921)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 587409..587567 157 N° 2 587724..587797 72 N° 3 587968..588083 114 N° 4 588336..588388 51
N° 5 588557..588625 67 N° 6 588853..588894 40 N° 7 589098..589202 103 N° 8 589460..589476 15
N° 9 589639..589712 72 N° 10 589945..590055 109 N° 11 590241..590317 75 N° 12 590522..590578 55
N° 13 590844..590921 76  
join(587409..587567,587724..587797,587968..588083,588336..588388,588557..588625, 588853..588894,589098..589202,589460..589476,589639..589712,589945..590055,59024 1..590317,590522..590578,590844..590921)


exon

Literature and cross-references CsorAPx05
Protein sequence: CsorAPx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343 (321)
PWM (Da):   %s   36431.58 (34229.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   10.33 (10.05) Peptide Signal:   %s   cut: 23 range:23-343
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTLPKRAASLLLLVLAIAGAQACPFASMVQGGDVEAVGRKLLQAT
CNVAALDR
TNQASPPAGPPTQTAVDVAVRNVAKQIIFFSTDRNAPGVGGAGAPNRNVRHGALLRQAFHDCTYVKTARTGGCNGSLRTGETGAAVNRNIVSTVALVQRYRQLINAEINRRIAAKQLPAG
TQISYADVFQLTGAAAVVATGGPANLFDRVE
MGRVDWATRTDDVSQLPDRNLGFTALSCRLSMGFTLRDMVALSAAHTLGAVNGRAMTPTPQTFDASDYFQLVSRGTAAFRTDNALTDSR
TA
LVQRWSNSANRGEMLAAFADAYIKMGRMNAMWRSYPQPAEYVRA*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGCTTCCCAAGCGGGCCGCGTCCCTGCTGCTGCTGGTGCTGGCCATCGCCGGCGCGCAGGCATGCCCCTTTGCGAGCATGGTGCAGGGCGGCGATGTGGAGGCCGTGGGGCGCAAG
CTCCTGCAAGCGACCTGCAACGTTGCTGCGCTGGACCGG
GGGTGCGCGGCCAATTGGAGCGGCCAATTGGCCGCTCGGCCCGCAATGCAGCGCAAGGCGCGCGCAGGCAGCGCTGTGGTC
CCTACCCGCCGCCGCCGCATCCTAGCCGCCAACCGAACCTTGCGCGATTCCCCACCAACCCCATTGGCCCCCCGCAGACCAACCAGGCTTCCCCGCCTGCTGGTCCCCCGACCCAGACGG
CCGTTGATGTGGCTGTGCGCAACGTTGCCAA
AAGTGCGCCTGCCGGGTCCCGCTGCCGCTTGCTGTTGTGCAGCGGTGCACCACCGCTGCCGCCGCTGGGTGGGGTGGCGCATTGCTGGC
CGGCTGGTGCTCAACCTCAAGCTGTTGCATCTCAGTGACGTGCTCCATTGATTTCAACGCTCATAAGGTTCATTGCTTTGCAGGCAAATCATTTTCTTCTCCACTGATCGCAATGCGCCT
GGCGTGGGCGGCGCCGGCGCCCCCAACCGCAACGTGCGCCACGGCGCCCTGCTGCGCCAAGCCTTCCATGACTGCGGAA
AAGTGAGTTGCCCTTTGTTCTGATGAAGTGCTAGCATGTGC
TGTGCTATGAAGTGCTGCTTGTGCTGCTGCGCCTGGCCTTGCAGGCTTCCGCACTGAGTGTGAAGGAGGTGTTCTACCAGCACCGCCTCATGCCAACCGCTGCCGCTGCCACTGCAAGTC
AGGACTGCATGTATGTACTTTGCCAACGCTGCCGTAAGGGCCCCAGTACACCACCTTCTCACATCCACCATCCTCTCCACCCTTGTTCCACAGCTTACGTTAAGACAGCTCGCACCGGCG
GCTGCAACGGCAGCCTGCGTACCGCG
CGGTGTGTACAGCGCACAGCCAGCACCGCACCGCACCGCACAGCATGCTGTGCATGAACAGCAAGCGCATCACCTGCGGTCTACCTCTGCTGTC
TCGAACGCCTGAAAGCCACCTGCGATCCCATGGCATTGCTGACTGCTGTCTCGCTGCTACTGCACTGTGCCTGCAGGGCGAGACCGGCGCTGCCGTGAACCGCAACATTGTCAGCACCGT
TGCGCTGGTGCAGCGCTACCGCCAG
AGGCAAGCGGCACTGCTGAAGAGAAACCTTGGTTGTTTGAATAATTGGACTGATGCATGTGCGCCCAGCTGGCGATCCGGCAGTCTGCTGCGACT
TGCAGGTTGTAGCCTGCGTTTGTTTGCATGCTGGGGTATGGCGGATGATGTCGAACTGCACTTCTTCCTGCTCCTGCTCACAGCTGCCTGCTTTGCCCTCTCACCTGACTGCAACTATTC
TGCGCTGCCTGCAGCTGATCAACGCTGAGATCAACCGCCGGATTGCCGCCAAGCAGAGGTGCGGCTGTGTAGCATGTGCAGAGGGGCAGTGCTGAGTGCTGGTGGAGGGCTGCTGAATTG
CAGTGCTGGGCCCCAGCACCCGAGCGGCGCAGCAGGCCGCCTCACGGCAGTGCAGACCACGGGTGTACGCTGGTTGCACTGCACTGTGCGCCGCTCAAACCCGCCGTAACTCTTCAAATC
CCCACCTGGTTGCCCCTGCAGCTGCCCGCCGGCACCCAGATCTCGTATGCCGATGTGTTCCAACTGACTGGCGCCGCAGCGGTTGTGGCCACCGGCGGCCCCGCCAACCTCTTCGATCGC
GTGGAG
AGGTGCGCGCCATGCCGTTCAGATTACTTTGTGTGCATGCATGCGTTCTGTATATGCCGGCAGGCACAGCAGGCTTCCGGCCACCACAGCCTCTTACAGCCTGCATGATTGTGC
GGGAGAGTGGTGTGCAGCTGGTCTGCCTTTTGCATCGCCATGCTGATCTGCCACTGCTGCAAGGCCTGGGAATCTTGGCTCCTGACTGCCGCCTACACTTCCCTCCCTCCCCTTCCTCCC
CCATGCAATGGTCCTTTCCTTGAAGATGGGCCGCGTTGACTGTGGTGAGCACGCCTGCTGTCCTGCCAGGTTTACGGTTGGGCCTTGTCGCACGTGAAATCATGAACAAGTGTAGGCTGT
TGCGCCGCGTCTCACTGAGCCAGCCTGGAGGCCAAGCAAGCTGAACAAGTCATCAACCCACCCGCTCCCCCGCCCCATGCCCGCAGGGCCACCCGCACCGACGACGTGTCGCAGCTGCCC
GACCGCAACCTGGGCTTCACCGCCCTGTCCTGCCGCTTCC
CCGTGCGTTCATGCTGCTGCTGCTGCATGCGTTGATCCTGCCGCTTCCGTGCGTCAATCCTGCTGCTGCATGCGTTGATC
CCGCTGCTGCCACCGCTGCCACGCCAGGGCTGGCTTCTGCTCTGGCCGCGCCCAATCAGCCAAGCATGCGCTTGTTGCCAGATGCCACTCCTGCCCTGCCTCCCCGCTGCATCGCCTCCC
CATAATCCGTATCTGTTCCCCCCGCCTGCCGCAGTGAGCATGGGCTTCACTCTGAGGGACATGGTGGCCCTGTCGGCCGCCCACACGCTGGGTGCTGTCAACGGCCGCGCCATGACCCCC
ACCCCCCAGACCTTTGATGCCTCCG
CGGTACGCAGCTACTTGTGCTGGTGGTGGCCTGGGGTCAGCTGCTGTAGCGCTGGTTTGGGCCTGCCGAGACTGTGCGGTGTGGCACCCAACCCA
GCTGGCATGCCTTCAGGTTTGCCCCGCAACCACACACGCTGTGCCCAGCAACCACACAAGCCACCTGCCGTTCCCTTCCATGCCGCACACAGACTACTTCCAGCTTGTGTCCCGCGGCAC
CGCCGCCTTCCGCACCGACAATGCGCTGACTGACTCGCGTACCGCCCAG
AGGTAGTGACTTTTGGTGGAAGGAAGTGTGGGCTTCTGCGGGCACTTGTGCTGAGCAAGTATGCGTCTGGC
AGCTTGGGGACAGCACCTGTAAATGGCTGACATGCCTGCTGAAGGAAGGCATTCCGTTTGCATGCACACAGCCGCGCTGACCTGGCTGGCTGGCTCCCTCCCTGCCTCCCTTCCTTACCC
CCTTGCTCTCTGCAGCTGGTGCAGCGGTGGAGCAACTCCGCTAACCGCGGCGAGATGCTGGCGGCCTTTGCGCGGTGAGGGCTGAGGGTCGCTGCCACTGCTGCCACTGCTGCGGGCGCT
GCTGCCAGTGTCGCCACACCAACCACGCTTAGCTGGACCCACGCTAGTTAATGAAAGGCATCACTTCACCGCAGAAGCAACCACCTCACTTGCCTCCCTCCCCCCAATTGCAGGACTCGT
ACATCAAGATGGGCCGCATGATGACAGCTCCCTTTCACCCTGTTTGGCGGGAAAACGAGCCAACCAGAACCCTGTTTGCCTCCCTCCCCCCAATTGCAGGACGCGTACATCAAGATGGGG
CGCATGAACGCCATGTGGCGCTCCTACCCCCAGCCCGCCGAGTATGTCCGCGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGCTTCCCAAGCGGGCCGCGTCCCTGCTGCTGCTGGTGCTGGCCATCGCCGGCGCGCAGGCATGCCCCTTTGCGAGCATGGTGCAGGGCGGCGATGTGGAGGCCGTGGGGCGCAAG
CTCCTGCAAGCGACCTGCAACGTTGCTGCGCTGGACCGG
ACCAACCAGGCTTCCCCGCCTGCTGGTCCCCCGACCCAGACGGCCGTTGATGTGGCTGTGCGCAACGTTGCCAAGCAAATC
ATTTTCTTCTCCACTGATCGCAATGCGCCTGGCGTGGGCGGCGCCGGCGCCCCCAACCGCAACGTGCGCCACGGCGCCCTGCTGCGCCAAGCCTTCCATGACTGCGGAA
CTTACGTTAAG
ACAGCTCGCACCGGCGGCTGCAACGGCAGCCTGCGTACCGCG
GGCGAGACCGGCGCTGCCGTGAACCGCAACATTGTCAGCACCGTTGCGCTGGTGCAGCGCTACCGCCAGCTGATCAAC
GCTGAGATCAACCGCCGGATTGCCGCCAAGCAG
CTGCCCGCCGGCACCCAGATCTCGTATGCCGATGTGTTCCAACTGACTGGCGCCGCAGCGGTTGTGGCCACCGGCGGCCCCGCCAAC
CTCTTCGATCGCGTGGAG
ATGGGCCGCGTTGACTGGGCCACCCGCACCGACGACGTGTCGCAGCTGCCCGACCGCAACCTGGGCTTCACCGCCCTGTCCTGCCGCTTCCTGAGCATGGGC
TTCACTCTGAGGGACATGGTGGCCCTGTCGGCCGCCCACACGCTGGGTGCTGTCAACGGCCGCGCCATGACCCCCACCCCCCAGACCTTTGATGCCTCCG
ACTACTTCCAGCTTGTGTCC
CGCGGCACCGCCGCCTTCCGCACCGACAATGCGCTGACTGACTCGCGTACCGCCCAG
CTGGTGCAGCGGTGGAGCAACTCCGCTAACCGCGGCGAGATGCTGGCGGCCTTTGCGGACGCG
TACATCAAGATGGGGCGCATGAACGCCATGTGGCGCTCCTACCCCCAGCCCGCCGAGTATGTCCGCGCCTGA

Retrieve as FASTA