Entry information : MsPrx12 ( prx2)
Entry ID 155
Creation 2006-12-27 (Christophe Dunand)
Last sequence changes 2016-02-16 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-16 (Achraf Jemmat)
Peroxidase information: MsPrx12 ( prx2)
Name (synonym) MsPrx12 ( prx2)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago sativa (alfalfa)    [TaxId: 3879 ]
Cellular localisation N/D
Tissue type Leaves
Inducers Pathogen interaction
Pseudomonas syringae infection
Repressor N/D
Best BLASTp hits
Perox score E-value MsPrx12
start..stop
S start..stop
MtPrx38 659 0 1..323 1..323
TrPrx02 614 0 1..323 1..329
GmPrx23 572 0 1..323 1..325
LjPrx04 555 0 1..323 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2035..2250 216 N° 2 2359..2559 201 N° 3 3027..3191 165 N° 4 4484..4873 390
join(2035..2250,2359..2559,3027..3191,4484..4873)


exon

Literature and cross-references MsPrx12 ( prx2)
Literature el-Turk,J., Asemota,O., Leymarie,J., Sallaud,C., Mesnage,S.,Breda,C., Buffard,D., Kondorosi,A. and Esnault,R. Nucleotide sequences of four pathogen-induced alfalfa peroxidase-encoding cDNAs. Gene 170 (2), 213-216 (1996)
Protein ref. UniProtKB:   O24080   Q93XK5
DNA ref. GenBank:   AJ306690.1 (2035..4873)
Protein sequence: MsPrx12 ( prx2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (298)
PWM (Da):   %s   35386.93 (32434.3) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.13 (9.13) Peptide Signal:   %s   cut: 26 range:26-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRYNVILVWSLALTLCLIPYTTFAQLSPNHYANICPNVQSIVRSAVQKKFQQTFVTVPATLRLFFHDCFVQGCDASVLVASSGNNKAEKDHPENLSLAGDGFDTVIKAKAALDAVPQCRNKVSCADILALATRDVINLAGGPSYTVELGRFDGLVSRSSDVNGRLPQPSFNLNQLNTLFANNGLTQTDMIALSGAHTSGFSHCDRFSNRIQTPVDPTLNKQYAAQLQQMCPRNVDPRIAINMDPTTPRTFDNVYYKNLQQGKGLFTSDQILFTDTRSRNTVNSFATNGNVFNANFITAMTKLGRIGVKTARNGKIRTDCTVL*

Retrieve as FASTA  
Remarks Complete sesequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGTTATAATGTTATACTAGTTTGGTCACTAGCATTAACGTTGTGTCTTATTCCATATACAACTTTTGCTCAACTTAGTCCAAACCATTATGCTAACATTTGTCCTAATGTTCAA
AGCATTGTTAGATCAGCAGTTCAAAAGAAATTTCAACAAACATTTGTTACTGTTCCTGCTACCCTTCGTCTCTTCTTTCACGATTGTTTTGTTCAG
GTATTTTTTTTTTTTAATTAATTA
GTTGCACCACTTTGATTAATATATTAATATTACTATAGTGTATTAAAAATTCTGATTTGTGATATGATTATTATTTTGTTATAGGGTTGTGATGCTTCAGTTTTGGTGGCATCAAGTGGA
AATAACAAAGCTGAGAAGGATCATCCTGAAAATTTGTCATTGGCAGGTGATGGTTTTGACACAGTGATTAAAGCAAAAGCTGCATTAGATGCTGTTCCACAGTGCAGAAACAAAGTTTCT
TGTGCTGATATTCTTGCTTTGGCTACTCGAGATGTTATTAATCTG
GTTTGTTCTTCAACTTGATTTGTTACTATCATTTTCTTATATTAAAAAGAGTTTTCATGTTGGTTTCTGTTGAAA
ACATGCTTTAATCTTGTTTCTAATATAATAATGTCTAGCATCTCATTGTAAAAAAAGTCAAGTTTAACGTTACAAAAAGATAAAACTTGAAAATAGTTTATAAATAGTGGTATTTTTCAT
GGCAATGATAAATTCCGTTTAAGATAAAAATTTAAGAATTTTTGTCCCTACGGTTTTCAACTTTTTATATTATTTTTGTTTCTCTATGCGGTTCCAACACCACACATATTTGAATTGTAT
TGTTCATGTGTCAAATACGATGTCCGAGTTTTGTGCACTCAAATAATGTGTATGTACAATTGCTTATGACACGTGATATGATATCAAAATCTATCTATATATCGATGAGAAAAATATCTT
TGATTTATCATTGTCAATTGTGTACACCACAGGCTGGTGGTCCATCCTATACAGTAGAATTGGGAAGATTTGATGGTCTAGTTTCAAGATCTTCAGATGTAAATGGAAGGCTCCCTCAGC
CAAGTTTCAATTTGAATCAGCTGAATACTCTCTTTGCAAACAATGGACTCACTCAAACAGACATGATTGCCCTATCA
GGTAATTGTCGAAGGCCACCATTTTAATTAAATGGGTCCCATT
ATCATATTTGTACTATGTGTCAAGATCCAAGAAAGTTTTTAAATGGCGGTAAAAATAAATAGTTTTGAAAAACCTTGACAAAAAAAGGATAATGTTATTTTTTTTAGGAGAAAACGAGAG
TTCTAACTTCTAAGTACATAATTAAATTGAAAAGATGACGTATCACATAAGCAAGAGATTCCTCTTTGACAAATGATCAGTTAAGTTTAGATAAAATAAAAAACACAAGGACCACTTAAG
AATATTTTGGTTACCAGAACTTTTTTTTTGTATAATTTTAAGGAAATTAAATTTTTAATATTTTGACATATTGACTAATGCATAAACAAATAATTATCATTGGTCAGTTGTGATTACTTA
ATTTAATGTGGTCACTAGAAATTATTGAGTGGTCACTACAAATTATTGAGTTTACTTTTATAGTTTAATTTTCGTATAGTCTCAATTTTTTAATTTTTGCTTTGGAGTTCGATATTGTGT
GGATATTTAGATAAATGTTAGTTTCATTATTTATATCAAATGTCAACTTAATTAAATGATGCTTGAAGAAAAAAAACTTAATTAAATGATGTCACAATCTTGTTTGGTTTTACGTCTCTT
TCTACTCTTTACACCTTTGAATATAAGTATAATTTTTTTTACAACAATAATACACTAAAAGCAAATTATAATTTTAATATACATAATCATGGTAGATAGGTTTTACATAATCACTAACAA
ATTATTTTAAATTTAATTATTTCAACAGACTCATCAAATAATATATCAAATAGTGAATCAAAATTAAATTTATCTATATGCATTATTTAATTTTTTACTTGTTGAATCTCAATAAAACAT
GTTGTATAATGTTCTCTAGGAGTGAATTGTTCATAGACACTAGCTTGAACTGTTTAAAAAATTATTGATAGACTCCATCTTTCAAATAATTCGTATATTAAATTAAATATAATAAAACCA
CAATCATTTGTCAATTTTAATCGAAATCTTATCAAATAATTTATGTCTATTATTAGTTTGGTGTACAAAATAAAATAAGTAAATATTTTTTTTAAAATATCTCAAAAGCTATTATAGTAA
GAGCATCCAATCCAAATCTCTAAAATAACATTAAGAAAAGAATCTAATCTTGAAGCAAAAGCCAACAAGTAAACAAAACAACAAAACTGAACCAGACAGTTCATACTTTTGTAGTATTCA
CATTTTGTTCCCTCTATGAATGTGCTTATTCTCTTTTTCATATTTTACAGGTGCACACACTTCTGGATTCTCTCACTGTGACAGATTCTCCAATAGAATTCAAACTCCAGTGGACCCCAC
ATTGAACAAACAATACGCTGCCCAGTTGCAACAAATGTGCCCTAGGAATGTTGATCCAAGAATAGCCATCAACATGGACCCAACAACTCCTCGAACATTTGACAATGTTTACTACAAAAA
TCTTCAACAAGGAAAAGGTTTATTCACTTCTGATCAAATCCTCTTCACTGATACAAGATCTAGGAACACTGTTAACTCTTTTGCAACTAATGGTAACGTTTTCAATGCCAATTTCATCAC
TGCCATGACCAAATTGGGTCGTATCGGAGTTAAAACTGCAAGAAATGGGAAAATTCGTACCGATTGTACTGTGCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGTTATAATGTTATACTAGTTTGGTCACTAGCATTAACGTTGTGTCTTATTCCATATACAACTTTTGCTCAACTTAGTCCAAACCATTATGCTAACATTTGTCCTAATGTTCAA
AGCATTGTTAGATCAGCAGTTCAAAAGAAATTTCAACAAACATTTGTTACTGTTCCTGCTACCCTTCGTCTCTTCTTTCACGATTGTTTTGTTCAG
GGTTGTGATGCTTCAGTTTTGGTG
GCATCAAGTGGAAATAACAAAGCTGAGAAGGATCATCCTGAAAATTTGTCATTGGCAGGTGATGGTTTTGACACAGTGATTAAAGCAAAAGCTGCATTAGATGCTGTTCCACAGTGCAGA
AACAAAGTTTCTTGTGCTGATATTCTTGCTTTGGCTACTCGAGATGTTATTAATCTG
GCTGGTGGTCCATCCTATACAGTAGAATTGGGAAGATTTGATGGTCTAGTTTCAAGATCTTCA
GATGTAAATGGAAGGCTCCCTCAGCCAAGTTTCAATTTGAATCAGCTGAATACTCTCTTTGCAAACAATGGACTCACTCAAACAGACATGATTGCCCTATCA
GGTGCACACACTTCTGGA
TTCTCTCACTGTGACAGATTCTCCAATAGAATTCAAACTCCAGTGGACCCCACATTGAACAAACAATACGCTGCCCAGTTGCAACAAATGTGCCCTAGGAATGTTGATCCAAGAATAGCC
ATCAACATGGACCCAACAACTCCTCGAACATTTGACAATGTTTACTACAAAAATCTTCAACAAGGAAAAGGTTTATTCACTTCTGATCAAATCCTCTTCACTGATACAAGATCTAGGAAC
ACTGTTAACTCTTTTGCAACTAATGGTAACGTTTTCAATGCCAATTTCATCACTGCCATGACCAAATTGGGTCGTATCGGAGTTAAAACTGCAAGAAATGGGAAAATTCGTACCGATTGT
ACTGTGCTTTAA

Retrieve as FASTA