Entry information : SaPrx[P]11
Entry ID 15978
Creation 2019-11-27 (Christophe Dunand)
Last sequence changes 2019-11-27 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2019-11-30 (Christophe Dunand)
Peroxidase information: SaPrx[P]11
Name SaPrx[P]11
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Orobanchaceae Striga
Organism Striga asiatica (witchweed)    [TaxId: 4170 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SaPrx[P]11
start..stop
S start..stop
SinPrx01 348 2.7e-121 58..264 124..330
SinPrx01 117 2.82e-31 1..91 1..98
OcPrx19 330 4.68e-114 58..264 125..331
OcPrx19 115 1.29e-30 1..74 1..74
MguPrx103 325 3.67e-112 46..264 103..322
MguPrx103 94 1.27e-22 10..74 1..65
RcPrx21 317 3.95e-109 58..264 128..334
RcPrx21 81 5.54e-18 25..73 28..76
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '15978' 'join(2505133..2505354,2505697..2505862,2506020..2506426)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2505133..2505354 220 N° 2 2505697..2505862 164 N° 3 2506020..2506426 405  
join(2505133..2505354,2505697..2505862,2506020..2506426)


exon

Literature and cross-references SaPrx[P]11
Protein ref. GenBank:   GER30962.1
Protein sequence: SaPrx[P]11
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   264 (237)
PWM (Da):   %s   28690.46 (25923.9)  
PI (pH):   %s   9.66 (9.28) Peptide Signal:   %s   cut: 28 range:28-264
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRKYFLATLLSLSLSVTVLLSGSASAQLKPNYYANVCPDVENIV
RRAVTAKFKQTFVTVPALIRLFFHDCFVS
SGGPMYTVELGRLDGLSSTAASVNGNLPQPGFNLNQLNAMFGSRGLSQEDMIALSACHTVGFSHCSKFSNRIYNFSRQNPVDPTLNPQYATQLQGMCPIKVDPRIAINMDPTSPRTFDNA
YFQNLVQGKGLFTSDQVLFTDTRSRNTVSTWASNSGAFNASFIQAITKLGRVGVKTGRDGNIRIDCGTFN

Retrieve as FASTA  
Remarks Pseudogene from genomic. Exon 2 is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGCGAAAATATTTTCTAGCGACATTATTGTCACTTTCTTTGAGCGTTACGGTCCTGTTGTCCGGCTCAGCCTCGGCTCAACTCAAACCAAATTACTACGCGAATGTTTGCCCTGAC
GTTGAGAACATTGTCAGACGAGCCGTAACCGCTAAGTTCAAACAGACTTTTGTTACTGTCCCGGCCTTAATCCGCCTCTTTTTCCATGATTGTTTCGTCTCG
CGGTAAATAATACCCAAA
GCTACTTTTTACCTTACGTCAGATTTCTTGTTCCACTTTCATCTGTTCAAATCAATATATTCTACTTATTAGCAACTTTCCATATTTTATTTTTTGAAAATTGTGCTATGAATGATAATG
TGCACTTAGTGAATTAGAAACATATGTAAACAAATATTTTTTTGTTCATTGTTANATATTCTTGCATTGGCTACTAGGGATGCAATTGTCCTGGTTCGTATTTCTTTTTTTTTTTTAATT
TAATTATTTTATTATTATTATTATTATTATTTTGAAGAATACAAATAAAATAACGAAATTAATAATAATAACTGGACCGTTTGCAGTCTGGTGGGCCCATGTACACCGTGGAGTTGGGCC
GACTGGATGGGCTGAGTTCAACGGCCGCAAGTGTGAATGGAAATCTGCCTCAGCCAGGCTTCAATTTGAATCAGCTCAATGCCATGTTTGGTTCCAGGGGATTGTCTCAGGAGGACATGA
TTGCTCTCTCAG
AGGTGCTTATTTGCTAACAATTAAATCTGGAAATTCATTTTATTTCACTAACAACACAGAAATTGTTAGGAAATATTAATTTCCAAAAATATCTATTTAATGTATCAA
AGAAATTTGTGTGTCATGTGCTCATATAGATTATCTTTTGGTACTATGCAGCCTGCCACACCGTAGGATTCTCACACTGCAGCAAATTCTCAAACCGAATATACAATTTCAGTCGTCAAA
ACCCGGTCGACCCAACCCTAAACCCACAATACGCGACCCAATTGCAGGGAATGTGCCCAATAAAGGTGGACCCTAGGATCGCCATCAATATGGACCCAACCAGTCCAAGGACGTTCGACA
ATGCCTACTTTCAGAATCTTGTCCAGGGCAAGGGCCTCTTTACCTCGGACCAAGTCCTGTTTACGGACACGAGGTCAAGGAATACAGTTTCTACTTGGGCCTCGAACAGTGGGGCCTTTA
ATGCTAGTTTTATCCAGGCCATCACTAAATTGGGCCGGGTTGGGGTCAAAACTGGGAGGGACGGCAATATCCGGATCGATTGTGGGACATTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGCGAAAATATTTTCTAGCGACATTATTGTCACTTTCTTTGAGCGTTACGGTCCTGTTGTCCGGCTCAGCCTCGGCTCAACTCAAACCAAATTACTACGCGAATGTTTGCCCTGAC
GTTGAGAACATTGTCAGACGAGCCGTAACCGCTAAGTTCAAACAGACTTTTGTTACTGTCCCGGCCTTAATCCGCCTCTTTTTCCATGATTGTTTCGTCTCG
TCTGGTGGGCCCATGTAC
ACCGTGGAGTTGGGCCGACTGGATGGGCTGAGTTCAACGGCCGCAAGTGTGAATGGAAATCTGCCTCAGCCAGGCTTCAATTTGAATCAGCTCAATGCCATGTTTGGTTCCAGGGGATTG
TCTCAGGAGGACATGATTGCTCTCTCAG
CCTGCCACACCGTAGGATTCTCACACTGCAGCAAATTCTCAAACCGAATATACAATTTCAGTCGTCAAAACCCGGTCGACCCAACCCTAAAC
CCACAATACGCGACCCAATTGCAGGGAATGTGCCCAATAAAGGTGGACCCTAGGATCGCCATCAATATGGACCCAACCAGTCCAAGGACGTTCGACAATGCCTACTTTCAGAATCTTGTC
CAGGGCAAGGGCCTCTTTACCTCGGACCAAGTCCTGTTTACGGACACGAGGTCAAGGAATACAGTTTCTACTTGGGCCTCGAACAGTGGGGCCTTTAATGCTAGTTTTATCCAGGCCATC
ACTAAATTGGGCCGGGTTGGGGTCAAAACTGGGAGGGACGGCAATATCCGGATCGATTGTGGGACATTTAATTAA

Retrieve as FASTA