1. Browse the Database
  2. View Redoxidase
Entry information : ZmPrx20(Zm00001d014467 / GRMZM2G085967 / Peroxidase39)
Entry ID 165
Creation 2006-06-05 (Christophe Dunand)
Last sequence changes 2006-06-05 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-09 (Christophe Dunand)
Peroxidase information: ZmPrx20(Zm00001d014467 / GRMZM2G085967 / Peroxidase39)
Name ZmPrx20(Zm00001d014467 / GRMZM2G085967 / Peroxidase39)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Meristems
Mixed tissues
Roots
Silks
Inducer Constitutively induced
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx20
start..stop		 S start..stop
SbPrx139 603 0 18..328 21..331
SofPrx01 587 0 18..328 21..331
SiPrx29 576 0 16..328 17..330
TaPrx18-1A 525 0 23..326 26..330
Gene structure Fichier Exons►


exon

Literature and cross-references ZmPrx20(Zm00001d014467 / GRMZM2G085967 / Peroxidase39)
Literature Duvick,J.P., Maddox,J.R., Navarro Acevedo,P.A. and Simmons,C.R.
Maize peroxidase genes and their use for improving plant disease resistance and stalk strength
Protein ref. UniProtKB:   B4FNI0  B6THU9
DNA ref. GenBank:   AC195863.2 (24939..27843)
mRNA ref. GenBank:   AY106450.1  BT038668
Cluster/Prediction ref. UniGene:   Zm.5808
Protein sequence: ZmPrx20(Zm00001d014467 / GRMZM2G085967 / Peroxidase39)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (306)
PWM (Da):   %s   35221.12 (33088.8) Transmb domain:   %s   o162-181i295-317o343-365i
PI (pH):   %s   7.41 (6.50) Peptide Signal:   %s   cut: 23 range:23-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVRRTVLAALLVAAALAGGARAQLKEGFYDYSCPQAEKIVKDYVK
AHIPHAPDVASTLLRTHFHDCFVRGCDASVLLNATGGSEAEKDAAPNLTLRGFGFIDRIKALLEKECPGVVSCADIVALAARDSVGVIGGPFWSVPTGRRDGTVSIKQEALDQIPAPTMNFTQLLQSFQNKSLNLADLVWLSGA
HTIGISQCNSFSERLYNFTGRGGPDDADPSLDPLYAAKLRLKCKTLTDNTTIVEMDPGSFRTFDLSYYRGVLKRRGLFQSDAALITDAASKADILSVINAPPEVFFQVFAGSMVKMGAIE
VKTGSEGEIRKHCALVNKH

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 3 introns) and 242 ESTs. Containing intron shift.

GeneChip® Maize Genome Array ID: Zm.5808.1.A1_at
DNA ►
Send to BLAST
CDS►
Send to BLAST