Entry information : MePrx07 (cassava4.1_011142m)
Entry ID 1666
Creation 2005-09-30 (Qiang Li)
Last sequence changes 2011-07-01 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx07 (cassava4.1_011142m)
Name (synonym) MePrx07 (cassava4.1_011142m)
Class Class III peroxidase    [Orthogroup: Prx150]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducers Pathogen interaction
Pseudomonas syringae infection
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx07
start..stop
S start..stop
HbPrx01 434 8e-154 3..330 2..333
PnPrx01 419 5e-148 10..342 7..343
PtPrx99 419 7e-148 10..342 7..343
PtPrx11_Trichobel 413 2e-145 10..342 7..343
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7686..7907 222 N° 2 8033..8224 192 N° 3 8411..8579 169 N° 4 8692..9137 446
join(7686..7907,8033..8224,8411..8579,8692..9137)


exon

Literature and cross-references MePrx07 (cassava4.1_011142m)
Literature Kemp,B.P., Beeching,J.R. and Cooper,R.M. cDNA-AFLP reveals genes differentially expressed during the hypersensitive response of cassava. Mol. Plant Pathol. 6 (2), 113-123 (2005).
DNA ref. Phytozome 12:   scaffold07430 (7686..9137)
Protein sequence: MePrx07 (cassava4.1_011142m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343 (320)
PWM (Da):   %s   37376.73 (35047.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.5 (5.79) Peptide Signal:   %s   cut: 28 range:23-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKHPSPLLMIVAGLVSAILVGAQLGYAQLSPTFYDQTCPNVSFIIREVILEAMLTDPRIDASLNRLHFHDCFVNGCDGSLLLDTTPTMEGEKEALGNNNSARGFDVVDTMKARLESACPGVVSCADILTIASQESVTLAGGPTWTNLLGRRDSFNASRAQANLSLPSPFMTLEELIVNFRNVGLPNVTDLVALSGAHTFGQAQCRTFRTRIYDSPELPLNSTYNVTLSRICSRNGTTDANSRTQLDATTPNVFDNQYFSNLQFGRGLLKSDQVLFSTPGSNTTEIVNRFTANRAVFFQSFVDAMIRMGNLRPLTGTEGEIRLNCRRRNGNLAEPGIRMVTSM*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCATCCTTCTCCATTATTGATGATAGTGGCTGGTTTGGTCTCTGCAATTTTGGTCGGAGCGCAGCTGGGCTATGCTCAGCTCTCTCCGACATTTTACGACCAGACTTGCCCAAAT
GTCTCCTTTATCATACGAGAAGTCATCCTGGAGGCCATGCTTACTGATCCCAGGATCGATGCCAGCCTCAACAGGCTTCATTTCCATGACTGCTTCGTTAAT
GTAAGTTAATTTTGCAAC
CACACATGTCATGATCTCTAAAGTTGCAAACGGGGATATTTTTGTAATTTTGACTGTTTCTTCTTTCTGAAATTCATTTATGAACGTATGGAATAATATTATAACAGGGCTGTGATGGAT
CACTCTTGTTGGACACTACTCCTACTATGGAGGGTGAGAAAGAAGCTCTTGGTAATAACAACTCAGCAAGAGGTTTCGATGTTGTCGATACAATGAAGGCTAGGTTGGAGAGTGCTTGTC
CTGGAGTTGTTTCTTGCGCTGATATTCTCACCATTGCTTCTCAAGAATCTGTTACTTTG
GTAATGCATATCACTATTAGCTTTCGACGAGTTTTTAATTATTCTAGTACATCAAACTTAT
TGCAATAAACTTAACAAAAATTATTTAAATATTTGATTTTTCTGTACATTGAATTTAATTTTGGATGGAGCTGGAGCTGACAGGTGCAGTTGAGCGTAGACTAATATAAATGAGATTGGT
TGCAGGCCGGTGGGCCAACATGGACTAATCTACTTGGAAGAAGAGATAGCTTTAATGCAAGCAGGGCTCAAGCTAATCTTAGCCTTCCAAGTCCCTTTATGACCCTCGAGGAGCTCATCG
TCAATTTCCGCAACGTTGGCCTCCCTAATGTTACCGACTTAGTTGCCCTCTCCG
GTGAGCTCATATATTGCTTATTAATTACAAAATATTGCAATCCCTCTAAGTTTTTTACTTTAGGGN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTTTTCAGGCGCTCATACGTTTGGACAAGCTCAATGTCGAACTTTTAGGACTAGAATATACGACTCTCCTGAACTACCATTG
AACTCAACTTATAATGTAACACTAAGCAGAATATGCTCAAGAAATGGAACGACGGATGCAAATTCGAGAACCCAGCTTGATGCTACAACACCTAATGTGTTCGATAACCAATATTTCTCT
AATCTTCAATTTGGCAGAGGTCTTCTAAAGAGTGATCAAGTTCTATTTTCGACTCCGGGATCTAATACTACTGAAATCGTTAATAGATTTACTGCTAATCGGGCCGTATTTTTTCAAAGC
TTTGTGGATGCTATGATCAGAATGGGGAATCTCAGGCCTTTAACAGGAACTGAAGGAGAAATTAGATTGAACTGTCGCAGAAGAAATGGCAATTTGGCTGAACCGGGCATTCGTATGGTT
ACTTCTATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCATCCTTCTCCATTATTGATGATAGTGGCTGGTTTGGTCTCTGCAATTTTGGTCGGAGCGCAGCTGGGCTATGCTCAGCTCTCTCCGACATTTTACGACCAGACTTGCCCAAAT
GTCTCCTTTATCATACGAGAAGTCATCCTGGAGGCCATGCTTACTGATCCCAGGATCGATGCCAGCCTCAACAGGCTTCATTTCCATGACTGCTTCGTTAAT
GGCTGTGATGGATCACTC
TTGTTGGACACTACTCCTACTATGGAGGGTGAGAAAGAAGCTCTTGGTAATAACAACTCAGCAAGAGGTTTCGATGTTGTCGATACAATGAAGGCTAGGTTGGAGAGTGCTTGTCCTGGA
GTTGTTTCTTGCGCTGATATTCTCACCATTGCTTCTCAAGAATCTGTTACTTTG
GCCGGTGGGCCAACATGGACTAATCTACTTGGAAGAAGAGATAGCTTTAATGCAAGCAGGGCTCAA
GCTAATCTTAGCCTTCCAAGTCCCTTTATGACCCTCGAGGAGCTCATCGTCAATTTCCGCAACGTTGGCCTCCCTAATGTTACCGACTTAGTTGCCCTCTCCG
GCGCTCATACGTTTGGA
CAAGCTCAATGTCGAACTTTTAGGACTAGAATATACGACTCTCCTGAACTACCATTGAACTCAACTTATAATGTAACACTAAGCAGAATATGCTCAAGAAATGGAACGACGGATGCAAAT
TCGAGAACCCAGCTTGATGCTACAACACCTAATGTGTTCGATAACCAATATTTCTCTAATCTTCAATTTGGCAGAGGTCTTCTAAAGAGTGATCAAGTTCTATTTTCGACTCCGGGATCT
AATACTACTGAAATCGTTAATAGATTTACTGCTAATCGGGCCGTATTTTTTCAAAGCTTTGTGGATGCTATGATCAGAATGGGGAATCTCAGGCCTTTAACAGGAACTGAAGGAGAAATT
AGATTGAACTGTCGCAGAAGAAATGGCAATTTGGCTGAACCGGGCATTCGTATGGTTACTTCTATGTGA

Retrieve as FASTA