Entry information : SsteMnP0410-1
Entry ID 16748
Creation 2017-04-20 (Catherine Mathe (Scipio))
Last sequence changes 2020-12-08 (Catherine Mathe (Scipio))
Sequence status N/D
Reviewer Not yet reviewed
Last annotation changes 2017-04-20 (Catherine Mathe (Scipio))
Peroxidase information: SsteMnP0410-1
Name SsteMnP0410-1
Class Manganese peroxidase     [Orthogroup: MnP002]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value SsteMnP0410-1
start..stop
S start..stop
SsteMnP09 405 6e-143 1..266 29..352
SsteMnP04 403 3e-142 1..267 32..342
SsteMnP02 400 2e-141 1..267 32..342
SsteMnP03 398 2e-140 1..267 31..340
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 68603..68720 118 N° 2 68037..68551 515 N° 3 67690..67818 129 N° 4 67633..67671 39
complement(join(67633..67671,67690..67818,68037..68551,68603..68720))


exon

Literature and cross-references SsteMnP0410-1
DNA ref. JGI genome:   scaffold_136 (68720..67633)
Protein sequence: SsteMnP0410-1
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   267
PWM (Da):   %s   27758.84  
PI (pH):   %s   4.81
Sequence 308
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
NKASNAACCPLFALRDDLQTNLFANQCGEDTHEALRLAFHDAIAFSSSLKHQGKPSGGGADGSMLIFPDVEPNFPPNNGIADSVDSLTPFLAAHPEISAGDLIQFSAAVGITNCPGAPRLKVLLGRPNATAPAPQGLIPEPTDSVTTILARFADAGNITASEVVALLASHSIARSDHVDPTIAAVPFDSTPFTFDTQFYLEVLLKGTGFPGACTWQGFINNQNSMASAFAAAMAKLSVVGQNTAKFIDCSEVVPKGAFFPATKSNRD

Retrieve as FASTA  
Remarks Warnings: Equal sequence : 12318;12338 Incomplte: gap,mismatches,gap to querystart,gap to queryend,
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACAAGGCTAGCAATGCAGCTTGTTGCCCCTTGTTCGCTCTTCGTGACGACCTCCAAACCAACCTGTTCGCTAATCAATGCGGTGAAGACACTCACGAAGCTCTTCGCCTCGCATTCCGT
AAGTAATTTGACCTTTCGAGGCTCCCCCCCGCTAATCTGGCTGCTACAGACGATGCCATTGCTTTCTCTTCCTCATTGAAACACCAAGGCAAACCCTCTGGCGGAGGCGCTGATGGCTCT
ATGCTCATCTTCCCCGATGTCGAGCCCAACTTCCCCCCGAACAACGGTATCGCTGACAGTGTGGACTCTCTTACGCCCTTCCTTGCGGCTCATCCTGAGATCTCCGCTGGTGACTTGATT
CAATTTTCGGCTGCTGTAGGTATCACCAACTGCCCGGGTGCCCCCAGACTCAAGGTCCTCCTCGGTCGTCCCAACGCAACAGCTCCCGCTCCCCAGGGGTTAATTCCTGAGCCAACTGAT
TCCGTTACTACGATTTTGGCACGTTTCGCCGATGCTGGTAATATCACCGCCTCCGAAGTCGTTGCTTTACTTGCATCGCACTCGATCGCAAGGTCTGACCACGTTGACCCCACCATCGCA
GCTGTTCCCTTCGATTCCACCCCTTTCACCTTCGATACCCAATTCTACTTGGAGGTCTTGCTCAAGGGTACCGGATTCCCCGGA
AGTGCCAACAACACCGGTACGTATGATACAATAATG
TGATCCGCATGGTCCGTATTTACATAGTACTGCAGGCGAACTCTCTTCTCCCTTGCCTCTCGGTAGCGGCTTGAACGTTGGCGAAATGCGTCTGCAGTCTGATTTCGCTCTTGCTCATGA
TTCTCGCACGTAAGTATCCCCTTACGCGCCACTCGATTGCGATGCTGATCCTCTTTGTCAGTGCCTGCACCTGGCAAGGATTTATCAATAACCAGAACAGCATGGCCAGCGCCTTCGCCG
CTGCTATGGCTAAGCTCTCTGTTGTTGGCCAGAACACGGCGAAGTTCATTGACTGCTCTGAAGTCGTTCCC
GCTAGCTTGCCCCAAACCAAGGGCGCCTTTTTCCCTGCCACAAAGAGCA
ATCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACAAGGCTAGCAATGCAGCTTGTTGCCCCTTGTTCGCTCTTCGTGACGACCTCCAAACCAACCTGTTCGCTAATCAATGCGGTGAAGACACTCACGAAGCTCTTCGCCTCGCATTCCAC
GATGCCATTGCTTTCTCTTCCTCATTGAAACACCAAGGCAAACCCTCTGGCGGAGGCGCTGATGGCTCTATGCTCATCTTCCCCGATGTCGAGCCCAACTTCCCCCCGAACAACGGTATC
GCTGACAGTGTGGACTCTCTTACGCCCTTCCTTGCGGCTCATCCTGAGATCTCCGCTGGTGACTTGATTCAATTTTCGGCTGCTGTAGGTATCACCAACTGCCCGGGTGCCCCCAGACTC
AAGGTCCTCCTCGGTCGTCCCAACGCAACAGCTCCCGCTCCCCAGGGGTTAATTCCTGAGCCAACTGATTCCGTTACTACGATTTTGGCACGTTTCGCCGATGCTGGTAATATCACCGCC
TCCGAAGTCGTTGCTTTACTTGCATCGCACTCGATCGCAAGGTCTGACCACGTTGACCCCACCATCGCAGCTGTTCCCTTCGATTCCACCCCTTTCACCTTCGATACCCAATTCTACTTG
GAGGTCTTGCTCAAGGGTACCGGATTCCCCGGA
GCCTGCACCTGGCAAGGATTTATCAATAACCAGAACAGCATGGCCAGCGCCTTCGCCGCTGCTATGGCTAAGCTCTCTGTTGTTGGC
CAGAACACGGCGAAGTTCATTGACTGCTCTGAAGTCGTTCCC
AAGGGCGCCTTTTTCCCTGCCACAAAGAGCAATCGTGA

Retrieve as FASTA