Entry information : EferPrx[P]46(Eurfer_11_g19432)
Entry ID 16798
Creation 2020-12-12 (Christophe Dunand)
Last sequence changes 2020-12-17 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2021-05-05 (Christophe Dunand)
Peroxidase information: EferPrx[P]46(Eurfer_11_g19432)
Name EferPrx[P]46(Eurfer_11_g19432)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Basal Magnoliophyta
Organism Euryale ferox    [TaxId: 4414 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EferPrx[P]46
start..stop
S start..stop
EferPrx101 542 0 1..295 1..321
EferPrx95 524 0 1..295 1..321
EferPrx[P]52 511 0 1..292 1..318
EferPrx48 451 2e-161 1..295 1..320
Literature and cross-references EferPrx[P]46(Eurfer_11_g19432)
Protein sequence: EferPrx[P]46(Eurfer_11_g19432)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   295
PWM (Da):   %s   30640.55  
PI (pH):   %s   8.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
MASSLPRRMA LVVLVVLAAT ATSVSAQLST TFYDTICPSA LSTIKAAVVS AVQQENRMGA SLLRLHFHDC FVQGCDASVL LDDTATFTGE KTAGPNMGSL RGFExxxxxx xxLGGPSWNV  PLGRRDSTTA SFGSANTDLP SPFSSLATLI SAFQAKGLNL QDLVALSGAH TIGQSRCSLF RDRIYNDTNI APLFALKRRL QCPRSGGDDN LAPLDNLTGN RFDNAYYLNL LFKRGLLHSD 
QELFNGGAAD AQVRTYSLNP LAFSRDFAVA MVKMGNISPL TGTNGQVRTN CRRVN 

Retrieve as FASTA  
Remarks incorrect prediction, exon 1 and start of exon 2 are predicted. Eurfer_11_19184273_19185013_g19432.t1_-1_CDS_2836092227_2418. End of sequence found 19184001 to 19184312 and 19183756 to 19184004.

19192784 to 19193173 other last exon, found GAHTIGQSRCSLFRDRIYNDTNIAPLFALKRRLQCPRSGGDDNLAPLDNLTGNRFDNAYYLNLLFKRGLLHSDQQLFNGGAADAQVRTYSLNPLDFSRDFAVAMVKMGNISPLTGTNGQVRTNCRRVN
CDS
Send to BLAST
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
ATGGCATCGT CCTTGCCCCG TCGCATGGCC TTGGTGGTGC TCGTTGTTCT TGCAGCAACA GCAACTTCGG TTTCAGCTCA GCTGAGCACC ACCTTCTACG ACACCATCTG CCCCTCCGCA  CTCTCCACCA TCAAAGCTGC CGTGGTCAGC GCCGTGCAGC AGGAGAACCG CATGGGTGCC TCCCTCCTTC GTCTCCACTT CCATGATTGC TTCGTTCAGG GGTGTGATGC TTCGGTTCTG 
TTGGACGACA CGGCGACGTT CACCGGCGAG AAGACGGCGG GACCAAACAT GGGCTCCCTC CGTGGCTTTG AGTCGTTGCG CTCGGTGGGC CTTCTTGGAA CGTACCGCTA G 

Retrieve as FASTA