Entry information : EferPrx[P]52(Eurfer_11_g02888)
Entry ID 16800
Creation 2020-12-12 (Christophe Dunand)
Last sequence changes 2020-12-17 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2021-05-05 (Christophe Dunand)
Peroxidase information: EferPrx[P]52(Eurfer_11_g02888)
Name EferPrx[P]52(Eurfer_11_g02888)
Class Class III peroxidase    [Orthogroup: Prx253]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Basal Magnoliophyta
Organism Euryale ferox    [TaxId: 4414 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EferPrx[P]52
start..stop
S start..stop
EferPrx101 592 0 1..318 1..318
EferPrx95 573 0 1..319 1..319
EferPrx48 494 2e-178 1..317 1..316
NaPrx01 455 5e-163 16..318 1..303
Literature and cross-references EferPrx[P]52(Eurfer_11_g02888)
Protein sequence: EferPrx[P]52(Eurfer_11_g02888)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317
PWM (Da):   %s   33607.09  
PI (pH):   %s   8.58
Sequence
Send to BLAST
Send to Peroxiscan
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
MASSFPRRMA LVVLVVLAAT ATSVSAQLST TFYDTICPSA LSTIKAAVVS AVQQENRMGA SLLRLHFHDC FVQGCDASVL LDDTATFTGE KTAGPNMGSL RGFEVIDAIK SAVDKACGAS  VVSCADILTV AARDSVVALG GPSWNVPL*R RDSTTASFGS ANTDLPSPFS SLATLISAFQ AKGLNLQDLV KLPSAHTIGQ SRCSLFRDRI YNGTNIAPFF ALKRRLQCPR SGGDDNLAPL 
DNLTGNRFDN AYYLNLLFKR GLLHSDQALF NGGAADAQVR TYSLNPLAFS RDFAVAMV*M GNISRLTGTN GQVRTNCRS 

Retrieve as FASTA  
Remarks Incorrect prediction, exons 3 and 4 are missing. Eurfer_11_2692245_2692987_g02888.t1_1_CDS_2836091630_5986
End of sequence found 2692946 to 2693503
(2685457 to 2685951, last exon, also found NLQDLVALSGAHTIGQCRCSLFRDRIYNDTNIAPLFALKRRLQCPRSGGDDNLAPLDNLTGNRFDNAYYLNLLFKRGLLHSDQELFNGGAADAQVRTYNFNPLAFSRDFAVAMV*MGNISRLTGTNGQVRTNCRSVN)
CDS
Send to BLAST
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
ATGGCATCGT CCTTTCCCCG TCGCATGGCC TTGGTGGTTC TCGTTGTTCT TGCAGCAACA GCAACTTCGG TTTCAGCTCA GCTGAGCACC ACCTTCTACG ACACCATCTG CCCCTCCGCA  CTCTCCACCA TCAAAGCTGC CGTGGTCAGC GCCGTGCAGC AGGAGAACCG CATGGGTGCC TCCCTCCTTC GTCTCCACTT CCATGATTGC TTCGTTCAGG GGTGTGATGC TTCGGTTCTG  TTGGACGACA CGGCGACGTT CACCGGCGAG AAGACGGCGG GACCAAACAT GGGCTCCCTC CGTGGCTTTG AGGTGATTGA TGCCATCAAA TCTGCCGTCG ACAAGGCGTG TGGTGCGAGT 
GTCGTCTCCT GTGCTGACAT CCTCACTGTT GCTGCACGTG ACTCAGTCGT TGCGCTCGGT GGGCCTTCTT GGAACGTACC GCTATGA 

Retrieve as FASTA