Entry information : EferPrx78(Eurfer_26_g17263)
Entry ID 16822
Creation 2020-12-12 (Christophe Dunand)
Last sequence changes 2020-12-17 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2021-05-07 (Christophe Dunand)
Peroxidase information: EferPrx78(Eurfer_26_g17263)
Name EferPrx78(Eurfer_26_g17263)
Class Class III peroxidase    [Orthogroup: Prx058]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Basal Magnoliophyta
Organism Euryale ferox    [TaxId: 4414 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EferPrx78
start..stop
S start..stop
EferPrx125 558 0 7..327 21..312
EferPrx91 548 0 7..327 21..331
EferPrx81 494 6e-178 2..327 18..314
EferPrx111 492 3e-177 2..327 18..314
Literature and cross-references EferPrx78(Eurfer_26_g17263)
Protein sequence: EferPrx78(Eurfer_26_g17263)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328
PWM (Da):   %s   35819.77  
PI (pH):   %s   4.74
Sequence
Send to BLAST
Send to Peroxiscan
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
SLLLATSFAQ LTPDFYSESC PGVFSAVHSQ IEIALEKEKR MGAWLVRMFF HDFFVNGCDG FILLDDTPTF VGEKKGGPNM NSVRGFEVID AIKAAVEEVC PGVVSCADII AIAARDSVLG  LGGPSWDVKL GRRDARTASQ ALANTSIPAP TSNLTQLISS FAVQGLSVRD MVALSGTVAN TFKRIRIHEN TLSVSHIIIV ELEAGAHTIG QARCTTFRNH IYKEINIDGF FAGTRQAYCP 
PSNGTDDNNL APLDINTPNF FDNSYYKDLI AKRGLLHSDQ ELFNDGSTDS QVWEYSENPD TFYADFMAAM IKMGDIKPLT GYDGEVRS* 

Retrieve as FASTA  
Remarks Incorrect prediction, contains two Prx ORF and two extra exons in 5'. one without start and one partial (last exon, AGVHTIGERRCTNFRNYMYNESNVDGFFARTRRGKCPPTKGSGDNNLAPLDINTMNFFDNSYYKNLIAKRSLLHSDQELFNGGSTNSQVESYASNPFAFNADFVAAVIRMGDIKPLTGNNGEIRKNCRRVN*). Eurfer_26_1311344_1328361_g17263.t1_-1_CDS_2836157588_8187
DNA
Send to BLAST
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
AAGTTTGTAG GTTGAAAAAG ACATTGTGTG GTCTTAAACA AACACTATGG GCATGGTGTG CATGTTTAAG TGAGACTCTC ATAAAAATTG GATTCAAAGA AGCCATTAGA GGAGCGCCAG  AAGAGAAAAG TGATCATAAT CCAGATAGAT GGGAGTATGA AACTTGTACA GTTGACTAAA CTATTTCATT CTTATCTAAT TCAAAATAAA TTAGTCACTA CATGCAATAT AATTTAATGG  GGTGCTTTAA TACACCTTTA TGACATAGTT TAATTTATAC CGATTCAAAC CACTCAAGTA GTATACGGAA TGGTTGATTT AAATGCATAT TAATTCAGTT GTTTAATGAA TCTATAAAGA  GGTGTTTGAT GTTTAAGAAA AAAATGTATG CATTATTTAC CATGGAAAAA ATTATTTGAA TGAAGTGGTA AAGAATTTTT TTTCCACAAA TTCAATATGA ATTGAATAGA AAGATCTTCT  GTGCTTGAAA TGAGCAGAAT AAAATTCAAA AAATTTGTGA AAAAAAGTCC ACCATGGATT TTTTTTCCAT GCTCATCAAA CACACCCTAA ATATTTGAAA TGAGGGCGTA TGATTAATTA  AATGTCCTTC AAATCGGACA GGTTTGCTTT GAAATTTGAT CATAGAAAGA CGCCTTGACC CCGTTTGACA GCCAGAACTC CAGCCTAAGT TGCCAATTGT TTTTCTTAGT TTTGATATGG  AACAGAGTGT GCCAAGCAAA ATCAATATGT CCGTTCTAAA TATGATAATG AATCTACTGT ACATTATTCT CTTTCCCCCT TTTTTACTAT GATTGATACA TATACAAGTG TGCCAAGCAA  AATCAATATT TGGATGAACA TTGGCACAAC ATAAATGCGA AGTGGTTAAA CCTCAATTAT TTGCTTGATC GGTACCATAC AACTTGTATT TCCTTTTGTC ACTGCCCAAT GGCTTCTTTC  TCTTCTATTG CGCTTGTCCT TGCCACTGCA GCTCTCTTCT GCTAGCAACA TCCTTTGCTC AGCTCACCCC TGACTTCTAT TCTGAATCTT GCCCCGGCGT TTTCTCTGCC GTCCATTCTC  AGATTGAGAT TGCTTTAGAA AAGGAGAAGA GGATGGGCGC ATGGCTTGTT CGCATGTTCT TCCACGATTT CTTCGTCAAT GTAAGAACCA TATCTATACT TCACATATTT CAAAGCCTTC  CTGTTAGTCT CTATCCAGTT GGAGACCACC AGTCTGAACT AAGCTAGTTT TTAAGACCTA CCAATCTAGT TGTTTAGATT CTCCATCGAC CACTCTTCTT GATTACTCGC CTCTTCCTGA  GCGCTTGGTA AACCAGAAAT TTAGAGAACA CAGTAGGTTG TTAACATGTT TTGATGGCTC TTAGGTGCCA AAAATCAGTT GTTCACCTCG TTGGTTCTTT GAAATGTTTC TGACGATATG  AGAGTTACGA TTGTCAGCTG AGAACTTACG GTTTCGCTTT TCGTTTGTTT CATACATGTA TAGAAACCGT CCTGTCAGCA AGAGCAGAAT TCACCATGGT ATGGTATTCG ATATGAAGGC  TTCAAGCCGA AGGAGGTTTA CTCACATCTA GCGTCTATCT CTCGACACAA ACTGGTGGGC TAGCTTCTGC TTAATTTCAG CGTCCGGACC AAGAGTCCAG GCCACACCTC TTGCACCAAC  CAGGCTCTGC TCATTCTAGT GTCTATCTCG TCTACGCTTG CAACTTCAGT GTCCACCGTA TTATCTATTT GATTGTCTAA CCTTTGCTAG ATGACTAGCT CTCTGGCTCT TCAATGGTGT  CCTCTCAGAA AGCGATGTTC TTTTACTACA TTTATCATGT CAACATCTAG AGTGCTAACA TTAGTGGCTC TGTTCTGATT TCTTGTTTTC TGCTGTAGGG GTGTGATGGC TTTATTCTGC  TGGATGACAC ACCAACCTTT GTCGGGGAGA AGAAAGGAGG ACCGAACATG AACTCTGTCA GGGGGTTCGA GGTGATCGAT GCCATCAAAG CCGCAGTGGA GGAGGTCTGC CCTGGTGTTG  TCTCCTGCGC CGATATCATA GCTATTGCAG CCAGAGACTC TGTCTTAGGG GTATGGCCAC TCATTTCTGC AGAAATAAAT AGTACCCGCA CAGATCATTC CTGACATTTG CAGCTAGATG  TTGATGATCT ACTGGTTTTT CACTGTGATA TTTTATGGTT TCTGGAGCAG TTGGGAGGAC CAAGTTGGGA CGTGAAGCTT GGGAGGAGGG ACGCGAGGAC AGCAAGCCAA GCTTTGGCAA  ACACTAGCAT CCCTGCTCCT ACCAGCAACC TTACTCAGCT CATCTCTAGC TTTGCTGTTC AAGGACTCTC CGTCCGAGAT ATGGTTGCAT TATCAGGTAC AGTAGCAAAC ACCTTCAAGA  GAATTAGAAT ACATGAGAAC ACTCTCTCTG TCTCTCATAT CATAATTGTG GAACTGGAAG CAGGAGCTCA CACCATTGGG CAAGCAAGGT GCACCACCTT CAGAAACCAC ATCTACAAGG  AAATCAACAT AGATGGCTTC TTCGCCGGAA CGAGGCAGGC CTACTGCCCT CCCTCTAATG GCACAGACGA CAACAACTTG GCTCCCCTTG ACATAAACAC CCCAAATTTC TTCGACAACA  GCTACTACAA GGACTTGATT GCCAAGAGGG GACTCCTCCA CTCCGATCAG GAGCTCTTCA ACGACGGCTC TACTGATTCT CAAGTTTGGG AATACAGTGA AAACCCTGAC ACCTTCTATG  CTGATTTCAT GGCGGCCATG ATCAAGATGG GAGACATCAA GCCTCTCACT GGCTATGATG GTGAAGTAAG GTATAACTGC AGGGTGGTGA ACTCATGAAG AGAAGATCAT CACAGTGTGC  ACTTTGGTGT TTCATTTTCG CTGTGACTTG TAAGAAGTGT AAGAGAGTGA AGACTTTGGC TCATTGGAGC CCTTTTGTCG TTTCTTTTCT TTTCTCTTTT CCTGATTGCG AAGGTTTAGT  AAAATCCCAG TTGTCGAACT CTTGACCTGA TCATTTCTTT CTCCTAAAGT TCCTAAAACG ACCATTTTGC TTGGAATGAA AAAGCTCTTT CTGTCACTCT TTTCAATGTA CTTGACTTTC  CTTGTTTCTC ATTGCCTATG TTTGAACTTC GAAATGTATT TGCTATCGTT TTGATTGCGT TCGAACTTCT TAAAATATTG ATGATACCCA TAAACAAAAA CCAAATACTT CACCACTACA  TATGATGAGC AAATGTAACA GGCAGAACTC TGAATAATGT TTTAATCCTG CCACTCTGCA GCCTTAGCTG TCATGGGGAA TCTACCTCTT TTCATTAGCA AAGACCCAAA AAACTTACCA  ATCGTAGCAT TTAAAACAGT TTACATATGA AATACATCGC GGAAGGCAAC CTTGACAGTA AGATTTTTTC ATAACAGTAC TCACCTTATT AATCATCTCG AAATGATTGA GGGAAATTGT  CGAAGAATTT GATTAAAAAA GATTTTTGGA ATGCTGTAAA TGAATGGTAG CTAGCATGTT TCTTTGCTAC ATTTTTTCAA AGCCTGCTAT GCATATCTAA TCTCCATGAT AACAAGTAAG  AATCGAGTGA CTTTCTAGAA ACCTGCAGAT ATATACAATC TTTTGATCAT GATTAACAAT TGACTGTCAA TAATTCCCTT AGGCTTATAA AATTAACCAT GTCTGCACAC TAAAAAAAAT  CGGCATGAAT TGTGTGCAAC TCCTACGCCT GTATTAAGCA TAAAATTAAT ATTCTCATAT TAATGTAACG ATCTTCCTAT TCACCCAGTC AGAATTCTTT CCTTGTATGA TTTCTTCTTC  ATATAGATAG ATATATGATC TATGGAGCAA TTACTTGGAA GTACTTTTTG TGCAACAGCC CTTCATATCT GATAGAAAAA GATCTCCTGA TATAAACAGA TCTTAACTGT GATCGAAAAT  CCCAAGTTTT TTTATTTAAT TAAAAATTGA ATTATTCAGT CTTTATGCTT AAATCCATGA AATTTTTATT CATTCTGAGT CGCAATGTGA AAGATGAAAA AAACCTCTTC TATCTTCTAA  CTTTTAATTA ATGGTAGCAA ATCAAATTGA TAAAAACAAC CCTTTATGAC TCAAATGCTA ATGCATTACT TTAAAAAGTC ATCTCCGTTC AAGTTCATCC CGCAACAATA AATCTTTGAA  AGTATTTAGC CTTGATTTTA TGTTTTTACA TGTTTCACAT TTACTTATCA TTTCCATCGC ATTTAATATT TCACCAATCA GATGCTTCCG TATGTGTCCG AAATGCATCT GCATGCTTTG  CATGTTCTAC AGTTCACCCA CGATTTTAGT AAAAAGAACA CAAACATGTA AGCACACTAA TCTAAGTCTT CCATTCCTAC AAAGCTAACT TGAGTTAAAA CTTATGGATT TGGATACTCG  TATATTTCTG TTAAAAAATA CTCTTTACGG AAAACATTTA GTTTTTTTGT CCCAATATCT AGAACAGTTA ATGGATTACC TATGCACCTA TTTGGTTGGT ACATTTGTCT AGTAATATTA  CACCATGGAT ATCAATGTTG TTAGGTAGGA TGATGCAATG TAGATGCTTG AGATGAAAAA TATAAATTAT ATAATATTTA TAATAAATAG GTTTAAAAAT AAAAAATAAT TTAATGTTAA  ATATTGATAA AAAACAAGTT TTTAACGTTA CTTTATAATA AAATGATATT TATAACTGAT GTCATGCATC ACACACCTTC ATGATGCACA CACATCATAG TTTTTAAATT AATTTAATAT  AAAAATACTT TTTTAATGTT AAAATTGAAA AAAATAAAAA ATAAATGTAT TGAAATAATG GGTGTGTGCA TTATGGGATG TCTTCATGAT GCGCATCATG CACGCATCGT GCATCATATG  AAGATGTGCA TGCATGCATC TAACACATTG ATGAATATCA CTACTTCATG TTACCAGTGG TAAACGTACG TAGAAATTTC TTGTGATGGA GGCATTTAGA TAGACCAATT GTGGGCATTG  CCTCTAAAGT AAAAACCCTT CATTTTCTCA AACTACCATT CAAATTTTCT TGGGCTGATG TTACCAAACG GATTATGCTA GTTAATCCAA TATTAACCAT GTTCTTTCTC CGGTCAGCCG  GTCAAGAAGT CCCCACAAAA AATAATGGAC GTTCCCTACT TGAAACAAAA GTAAAATGGT TTTATAAGGA GTTAATCCAT GAAATAATAC TTAATGGCTT TCATTTTACA TGTATACAAA  GGGGCACGCA CATACATGCA TTTGCATTTT CGAAGCTCAA CGTCGCCAAT CATTCTAATA GTTGCATTGA AACTTGACTA CTCGTATCAA ACCACACATA AGAATGAACT TTCGGGAGGA  TGCCCAACTA ACTCATAAAG ATTGACTCTG TTTCTTGCGC TGATTAATTT ATTTGGTTGC GTTAGATTAA TGGTAGAGCA GCAAGTTGAC AGTGTTTGCA GTAAAGAAAG CAAAACAAAG  ATAGGCATAT CACCAACAAT GTTATTAGAT GCAGACCCAT TAATGCTCGT ATCACCTTAA AAACACAATA TGTGGACCAT TTTTTAGTGA TGCGAACATT ACATGGTGGA TCCGTATAAA  TGGTTGGTAC GGACACACCG AATAAAAAAA AGATGTGCTG ATGTGCACCT ATCAAGACAA GGAGAGAGAA GTCTAGTATC TACTAAGCTG ATTCTACAAA GTGCAATTAT GATTCATTAT  TTTTGGATTT TTTTCATCAC TTTTAGAACA CAAAGCAAGG AAGAATTCTT GAATTTGAAA CTTTTTTTAT CAAACACGTC ATGTTAAAAT TTTGATTATG GAGTTTTAGT TCAGAAATTT  TGATTATATG GTCATAATTC AAAGTTATCA AACGCGTCCT TGAAATAACA GGGAGGATGT TGTATGATGC TAGGGAATGT TAGAGCATAG TGTTGTTAAG CCGTTGAGTT TGAGGTATGA  ATCTCGTCTT CAAACTTCAA AGTGGTGAGT TAAGATGCAC TATCGCTTGT TGTGTGTGCC TCTCACACAC ATTACGGTGT TGTGCTTGAT GCATATGGAG GACACTTGGC GCTGCACACG  AGCTGAGCTT AGCCCAAGCT GGGACAGCCC AACTTGGCTC AGCATATCAA AGAACGAACA CGACTCGAAC GAGACAAGTT TGAGTACAAA TGATACTCGA ATTTGACTTG ATAAAGTTGA  CTATTTTTTT TTTTTTGCAA CCCTCTTGCT CATTGAACTC CATGAGTTCT CTTGAAAACA ACGTAACAAA TTATCAATTA GCAACATAAA ATTCTAAATA TATCATAAAA AAATTAACCA  TTAAGTTTCA AACTTCCTTG AGGTGAGTTA AGTTTCAATA AGTCGAGTGT GGCAAACTCA AAACTCGACG CAGTCATACC AACGAGCCGA GACTCGAACT CATGATTGAC TATCGAGAAA  AAACTTGGCT CAAACTCACC TGCCAGCCTA GTTTTGTGTA AATGATTTTT TTCCCACAAA TTCAACATGA ATTGAGCAAA AACTTTTTTG TGTTTGAAAT GAACAGAAAA AAAAATCGAA  AATTTGAGAA ATGGACATCA AACACACCAT TAGGGACTTT TCTTTGTTTA AAACCAGAAT AAGTTTCATG TTTTGACCAA GTTTTTTCTT GTATATTTAG TTGAAGGATT AGATAAGAAA  TTGAAATTTG CTTTATATTC TAATCAAAAC CTCTTTCGGA TTTAGTTGAA ATTGGTAACA TGTAATTGGA CACCAAATTT GCTTAAACAG TCTAGTAGAA AATGAATTTT GTTATCACAT  TTTTGTTTAG TATGTCATGT TTTCATATTA AAATATAAGC AAAATACTTT TTAGTTATAG TTTCTTAATA GTTTTAATTT TAATATCATT TTTACGAATG TTACATATTT TATAACCTTC  GATCTTAAAC TTACGTTTGG CTTCGCTTCG AAATACTCCA CCTTGTTTCA CAGGCTTAAA GGTTTTATTC GTTTCATCAC ATTTAATAAC ATGATTACAA TAGTTATTAT TAGGGGTGGG  CCAAAAAAAT ATATTTTGGT TATTGATCTA TAAAATGGAG GGAATGAAAA TACCGATTCA AAATATTACA ACTGTGGAAG CAGGAGTTCA CACCATTGGG GAGAGAAGGT GCACCAACTT  CAGAAACTAC ATGTACAATG AGAGCAACGT AGATGGCTTC TTTGCCAGGA CAAGGAGGGG CAAGTGCCCT CCCACCAAAG GCTCAGGTGA CAACAACTTG GCTCCTCTTG ACATAAACAC  CATGAACTTC TTCGACAACA GCTACTACAA GAACCTGATT GCCAAGAGGA GCCTCCTTCA CTCCGATCAG GAGCTCTTCA ATGGTGGATC CACTAATTCA CAGGTTGAAT CTTACGCTAG  CAACCCTTTC GCCTTCAATG CCGATTTCGT TGCAGCAGTG ATCAGGATGG GAGACATCAA ACCTCTCACT GGAAACAATG GAGAAATCAG AAAGAACTGT AGAAGGGTGA ACTGAAGGAT  TGAAGAGAAT CACCTAAATT AATCATCATT ATGACTGCCG TGTTAAGCAA AACCAGTTTT AATAGATTGC TAGTTTTGGT TGTAAGGACT GTAATGCTCC TCCATCGTTC CATAACCAAG  AGAAAAAGTC GATGAGGTAT CCATCTACCC TAGGAGCTTT AAGGCCAGAT AGCTGCTGGA TGGCGGCATG TATTTTCTCT GCCATAAAAA ACACTCTCCA ATTGAGCCGA TTGAGAGTTT  AATAGTCATC TGAAGCCAGT AAGGCCGATA CTCTGTGGCA GTGAAGGGCA CAATAGAAAA AAATCTGAAA TGAAACAGGA AGCATCAGGG AGCGTTTGAT CCTACGAGAG AACACAGCCA  TTTAAAGTTA GCACAGAAAT GCAGTTGGCA CTGTATTTGG TGCAGGCATG TTCATGAAAG AAATAAGTGT TGGAATCGTC GGCTTGGAGC CAACAAATGC GAGAATACTG TCTCCACTTA  AGTTCGCCCT TGACTTTCTG TTCGAGGATA AGAATATGAA GCTCCTGGCA CTGCCCACAT GAAGATGATG AGGAATCCAT TGTCAACTTT GAAAGTTCTG CTTCCCACAC CTTAAGTTGA 
TGATCGGAGT GGTGAAGGTG CAGATGCATC CACTGCTTGA TACTAAGAGT AAGTCGCTCC ATTTTGGTGA GAATCCTGAT TGCAACA 

Retrieve as FASTA