Entry information : ZmPrx06 (Peroxidase J)
Entry ID 169
Creation 2006-08-29 (Christophe Dunand)
Last sequence changes 2006-08-29 (Christophe Dunand)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx06 (Peroxidase J)
Name (synonym) ZmPrx06 (Peroxidase J)
Class Class III peroxidase    [Orthogroup: Prx060]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducers Cyst nematode infection
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx06
start..stop
S start..stop
SbPrx46 552 0 1..320 1..319
SiPrx120 543 0 3..320 42..351
CciPrx02 517 0 3..320 2..313
TaPrx20-1A 466 4e-167 1..319 1..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 172768130..172768336 207 N° 2 172768545..172768742 198 N° 3 172768855..172769412 558  
join(172768130..172768336,172768545..172768742,172768855..172769412)


exon

Literature and cross-references ZmPrx06 (Peroxidase J)
Literature Hainey,C.F. et al., unpublished
Protein ref. UniProtKB:   Q9ZTS9 [Fragment]
DNA ref. GenBank:   AC210153.3 (45893..44580)
Cluster/Prediction ref. UniGene:   Zm.2707
Protein sequence: ZmPrx06 (Peroxidase J)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (298)
PWM (Da):   %s   33077.25 (30986.2)  
PI (pH):   %s   6.64 (6.65) Peptide Signal:   %s   cut: 23 range:23-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSVSSCLLLLLCLAAVASAQLSPTFYDSSCPNALSTIKSAVNAAVQKENRMGASLLRLHFHDCFVQGCDASVLLADNAATGFTGEQGAAPNAGSLRGFDVIANIKAQVEAVCKQTVSCADILAVAARDSVVALGGPSWTVPLGRRDSTTASLSLANSDLPPPFFNLGQLITAFGNKGFTATEMATLSGAHTIGQAQCKNFRDHIYNDTNINQGFASSLKANCPRPTGSGDGNLAPLDTTTPYSFDNAYYSNLLSQKGLLHSDQELFNGGSTDNTVRNFASNSAAFSSAFAAAMVKMGNLSPLTGSQGQIRLTCSTVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, intron 1 and 2) and 11 ESTs. Also found in AC211735 (contains 3 peroxidases: ZmPrx06, 42 and 56).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTTCCTCGGTCTCATCCTGCCTGCTGCTTCTCCTGTGCTTGGCGGCGGTGGCGTCCGCGCAGCTCTCGCCGACGTTCTACGACTCGTCGTGCCCCAACGCGCTGTCCACCATC
AAGAGCGCCGTGAACGCCGCCGTGCAGAAGGAGAACCGCATGGGGGCCTCCTTGCTCAGGCTGCACTTCCATGACTGCTTTGTCCAG
GCAAGCTCAGCTCATTCATTCATTCATTCCCTA
GCTTCGATCGCTTCCTTATGCAGTTTATCTGTACACGGCCATCACTTACTAACTGCATGCACTTCACTCACTGTGTTTAAGAGCGCTCCTGTTTGCATGAGCAGTAAGAATTTTTTACAC
CCCCGATGTGACAGTTAGTTCCTATTAATTAAATTAATGTTCTCGATGACATCAGGGGTGCGACGCGTCGGTGCTGCTTGCCGACAACGCCGCCACGGGCTTCACCGGCGAGCAGGGTGC
TGCGCCCAACGCCGGGTCGCTGAGGGGCTTCGACGTCATCGCCAACATCAAGGCACAGGTGGAGGCAGTCTGCAAGCAGACCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGTGA
TTCCGTCGTCGCG
GTAAGCAAAGAAAGACCACGACTGCATGCGTAGAGAGGGGCTTGGTAATGATCCACACCATGCATGCAGCTGCTGCATCAAATCGATTTCTGACGCATATGCTGACG
TGCAGTTGGGCGGGCCGTCATGGACGGTTCCTCTGGGGCGGAGGGACTCGACGACGGCGAGCCTGTCCCTGGCGAACAGCGACCTGCCGCCTCCCTTCTTCAACCTCGGCCAGCTCATAA
CAGCGTTCGGCAACAAGGGTTTCACCGCGACCGAGATGGCCACGCTCTCCGGCGCGCACACCATCGGGCAGGCGCAGTGCAAGAACTTCAGGGACCACATCTACAACGACACCAACATCA
ACCAGGGCTTCGCGAGCTCGCTCAAGGCCAACTGCCCCCGGCCCACCGGCTCCGGCGACGGCAACCTGGCGCCGCTCGACACCACCACGCCGTACAGCTTCGACAACGCCTACTACAGCA
ACCTGCTGAGCCAGAAGGGGCTCCTGCACTCGGACCAGGAGCTCTTCAACGGCGGCAGCACCGACAACACCGTCAGGAACTTCGCGTCCAACTCGGCCGCCTTCAGCAGCGCCTTCGCCG
CGGCCATGGTGAAGATGGGCAACCTCAGCCCGCTCACCGGATCTCAGGGCCAGATCAGGCTTACCTGCTCCACAGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTTCCTCGGTCTCATCCTGCCTGCTGCTTCTCCTGTGCTTGGCGGCGGTGGCGTCCGCGCAGCTCTCGCCGACGTTCTACGACTCGTCGTGCCCCAACGCGCTGTCCACCATC
AAGAGCGCCGTGAACGCCGCCGTGCAGAAGGAGAACCGCATGGGGGCCTCCTTGCTCAGGCTGCACTTCCATGACTGCTTTGTCCAG
GGGTGCGACGCGTCGGTGCTGCTTGCCGACAAC
GCCGCCACGGGCTTCACCGGCGAGCAGGGTGCTGCGCCCAACGCCGGGTCGCTGAGGGGCTTCGACGTCATCGCCAACATCAAGGCACAGGTGGAGGCAGTCTGCAAGCAGACCGTCTCC
TGCGCCGACATCCTCGCCGTCGCCGCCCGTGATTCCGTCGTCGCG
TTGGGCGGGCCGTCATGGACGGTTCCTCTGGGGCGGAGGGACTCGACGACGGCGAGCCTGTCCCTGGCGAACAGC
GACCTGCCGCCTCCCTTCTTCAACCTCGGCCAGCTCATAACAGCGTTCGGCAACAAGGGTTTCACCGCGACCGAGATGGCCACGCTCTCCGGCGCGCACACCATCGGGCAGGCGCAGTGC
AAGAACTTCAGGGACCACATCTACAACGACACCAACATCAACCAGGGCTTCGCGAGCTCGCTCAAGGCCAACTGCCCCCGGCCCACCGGCTCCGGCGACGGCAACCTGGCGCCGCTCGAC
ACCACCACGCCGTACAGCTTCGACAACGCCTACTACAGCAACCTGCTGAGCCAGAAGGGGCTCCTGCACTCGGACCAGGAGCTCTTCAACGGCGGCAGCACCGACAACACCGTCAGGAAC
TTCGCGTCCAACTCGGCCGCCTTCAGCAGCGCCTTCGCCGCGGCCATGGTGAAGATGGGCAACCTCAGCCCGCTCACCGGATCTCAGGGCCAGATCAGGCTTACCTGCTCCACAGTGAAC
TAA

Retrieve as FASTA