Entry information : Esil1CysPrx01(Esi_0192_0041)
Entry ID 16925
Creation 2021-01-28 (Christophe Dunand)
Last sequence changes 2021-01-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2021-01-29 (Christophe Dunand)
Peroxidase information: Esil1CysPrx01(Esi_0192_0041)
Name Esil1CysPrx01(Esi_0192_0041)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Esil1CysPrx01
start..stop
S start..stop
Hpe1CysPrx 270 9e-93 9..221 3..213
Spur1CysPrx 269 2e-92 10..223 4..216
Sdo1CysPrx 267 9e-92 10..221 4..212
Dp1CysPrx 254 2e-86 8..223 6..220
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 283770..283838 69 N° 2 290747..290867 121 N° 3 291470..291611 142 N° 4 292151..292301 151
N° 5 292823..292957 135 N° 6 293289..293348 60  
join(283770..283838,290747..290867,291470..291611,292151..292301,292823..292957, 293289..293348)


exon

Literature and cross-references Esil1CysPrx01(Esi_0192_0041)
Protein ref. GenPept:   CBN79130.1
Protein sequence: Esil1CysPrx01(Esi_0192_0041)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   225
PWM (Da):   %s   24144.08  
PI (pH):   %s   5.08
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSDPVALLLGDKFPDFEAETTAGPIKLHDYLGSSWGLLCSHPADFTPVCTTELGTCAKLNVEGGEFPKRDVKMLAISCDPLESHQGWIGDIKAHTGHEVNFPLIADADRSIAASLGMLHPDHMSAEGLPMTVRTVYVISPEKILKLALTYPASTGRNFDIIRAIDSLQLTATRSLATPADWQKGGSCMVLPTVSPEDAAEKFPEHKTMEVPSGKGYLRVTPTS*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCGACCCCGTTGCCCTTCTCCTCGGCGACAAGTTCCCTGATTTCGAGGCAGAGACGACGGCGGTGAGTGGGTGTGTACTGGAATGTTTATGACTGTTGGCCGCAGTGCGCCGG
AACAAAAACTATGAGAACATGTTCGATAGCGTGCTTGCCCTGAATCGGAATGCATCGAAAAAAGCTCCGCTCACATGTCGTTGAGAGTCACGGCTGTGCCCCGAACGGTGATTTGTCTTT
CTACAGGGACGCCGCTGCTGCGGTTGTCGTCACCCTTCCGATCTCTACCCAGCACTTCCCAGCTTCCCAGTATCAGTACTGGTCCAACTTCCGCGGATGCCTTCCGTGGCCACAGGCGAA
AAATAAGTAGTTGTAGACTCTCCACACGACAGCAATTAGTGTACAGCAGCAGTAGAACGAAACATGAGAGAGAATCAATGTAGAACCTCGAAACAAGAAACGCAATGCATCGGAGTTTTG
TACGAATACGAGAGTCTCCCTTGCGGACGTGGGTGTCAAGTCTCGCGAAGGGTGACCCTAGGATAACATGCCCAAGATGTTTTGTGCATCTAATGATCGATCAAGTCAAATGTAGTTCTT
GTGTTCCATACGAACATAAAACACCGAATGTACCAGCTCGGGCGGACAACAATTCATCCGCATCATCACCCTGCGCTGGTTCGACGATTTTTCTCTTGCGATTACAGCAATTTACCAATT
TGGAACTGCATGGTAATGATTGAAGGCAAGCACCGCGGGAGGAACGGTGGTCTTCCTCTTTTGTGACCCGGGCTGGTGTGTCAAACATGCACCGAAAGGGGTCGACAATCCTTTGTCACC
GCCTCAAACAGGCACAGCAGTAGGTAGGGTCTTCCCGCTACGACAAAGGGCGGGGTATTTAGCCGCGGGGTATCTACATACGACCTACATATCGTGCGGTAGTCTATCGGCCATGTAGGG
CGTTTTTGGACGCCGATGAAAATAAATGAGCAGTGGCCAAAATCGGGTACACCCGGTCCAAACACGGCCATAGTCGGGTACCCCTACAAAATGCTGCTGGGAGCGACCGCATGACACCAT
CTGATTGGCCGACGCCCGCCCCTACCCGACCTTGACCGTCTTTTCAACGGGTGCACCCGATCTTGGCTACTCACCCCCCGGAGGGGTACCCGGTTTTCTTTCCCCTACCCGAAAATGACC
GGGCTGTTCGGACCAAAACCCATGCACATAAGTACACGTGAGCAACGCCCTGCCCTCGAATTCGGACGTTCTGACGGCCCGGCGGGCGAAGGCAGACCCCCCGCCGGCGGTGGAAGCCTC
CCTTGGGGGAAACGGCAGGCGGTCTGTGCAAATGATCGAGAAGAAGAGCTGGATGAATCCCTCACTCACGAGATGCGACACAAACAAGACTCTTCTAAGAATAGACATATTCTCTCCCTC
CCGCTGCTTTCTCATTGACGACAAACGAGGGCCAGCGGTGTGCCTCCTCCGACCCGTGATTGTGTGCATGGGTTTTGGCCGAACAGCCCGGTCATTTTCGGGTAGGGGAAAGAAAACCGG
GTACCCGTCCGGGGGGTGAGTCGCCAAGATCGGGTGCACCCGATGGAAAGACGGTCGAGGTCGGGTAGGAGTGGGCGGCGGCCAATCAGATGGTGTCATGCGGTCGCTCCCAGCAGCGTC
TTGTAGGGGTACCCGATCATGGCCGTGTTTGGACCGGGTGTACCCGTTTTTGGACACTGCTCAAAATAAATCACCAGAATAGCGAGGAGTCCAGCCCGCACCACGCCCACACAGTAGCGC
GCATCGTTTGTAGTGTAGCTAGGTGCACCAGGAACAGGCGTGCGACAGGCGCGGCGGGAGGTACTTGTATGTGCAGCCCCTATTCATATTACGGTGTATGCGGCGCTAGATTAGCGCTTG
TATGGCTTTTTTCTAGGTTAACCCGGTGCGCTATTTACTCAAATTCCGATTACATAAGTTTCCTTGAAGGAGCATTTGACCCTACACAAGTAAGACAGAACACACCTTGGACAATAGGCA
ATAGGACGATTGCAAATCAATAGGATCCTACCAATCAATATGGGACGGCAGCTGCTGTCTACCATGTGCGTGTCGATGATTCATCGAGACCCCTATTGGCGGTCGTCAAAGCGTATCGAT
TCGCAATTTCGCTGACTATCGAATCTTTCAATAGTCTATCAACAGAATATCGCTAACCTATCGTAGTGTAAGTCGACCTTCATCGATGCGTATTTTTTGCAAGACATTGTTTTTCCGATA
CCCTACAATGCTCAGGAATAAAACATGTTGTATTCTTCAATAGGCATCGATGTGTGATGTGTTACCGTAGACGACACAAGATAACACACCCACACAAGAAACCACACCCCCCACAGAATA
CGACACCCCGGTGATAATTTTGGGCGTTTCTGACAAACCATCGGTTTATCACCGGGGCTACACAAGATAACACACCCCGTGAGGTTACACCGCATACATTCACGGGGCCCCTCCTTCTAT
CGCCGGGGTGATACAGCATCTGCCCCGTGGGCATGTGGGCATCCCACACACACGCAGCATCTGCGTAACTCTCTTTTGGTCGTACCCAATAGCAAGGTATGCAGCAGCCTACTCTTTTGT
ATGAGGGGGCAGGACGGTCGGCGCACTCTGTGGCCACCGAGGTCATGAACTCAGGAGTTTTGTCACCTCCGTTGAGCTCCTGCATTTTTACAACATTCCGCAGAACCACAAGTCATGAAG
TGTTCGTACAGGCGTTGCTATCACACACCCGGAATACCACACCCCTTCAAGTGTGCGGCAGCAGCGGTTCAACTCTACAAGCAGTGTTATAACACCCCCTTTTTTTTCACACACCCTCAT
TATCACACCCCCAAACACACCCTGTGGGTATTCGGACGTGCCATCACACCCCCTTTTTATCAATCCCTCATTTATCACACCCCCAAACACACCCTGTGCGTGTTCAGACGTGCTATCACC
CCCCGTCAGGGGCCCCTGCGAGCTGCACTTTATCACCCGGGTTACACAAGATACCACACACCCCACAGGATACCACACCCGGTGATAATATTTTTTAAGCCCAAAATGTTGTCACCGGGT
GTGTTATCTTGTGTCGTCTACGGTAAGCATGTTGATTTCATCATTGGTATGCATACCGATACGTGATCTTTGCTAGTGACCGAGCACGCAAACTTGAAAATGAGCAACTCCTCTTTGCGG
TAGTATATGTCGTGGCTCCCTGTGGTCCCGCCCCTTCGCTAATGAATATCCATCACCTTAGCTAGATGTCGTTGTTGGTGTTCCGCAGCTGCACTCGCACTGCTGTTGAGCTACCGCATC
GTATGGCAATTGTGACGAGTGTATCCCATATTCGGTAAGGGTACAATATCGTTATTGCTACCGATTGGTGACTAGTGTTTTCCACCCCAACGTTTAGTAAAAACCAATGTGGTGGATTCC
AATAGAAAACACCAATCGGTGATTGGTAAAAAAGCAATCGGTAAGAACAATCAACAGTTTTTGATCGGCAATACCCTATCGGTCGCGCAATAGACTATTGTAGCCTCTGGTGTTAACCTA
TTGTTTTCTTGCGATGCCTATCGATATTCCGAATCTTATTGCTATGATATGTGACTGTAGTTATTGATAGCTTTTTTTCTGACTTATTAAAAAACTCGAAACCCAATTTCATACCCTATC
ATCCAAGGTGTGAGGACAGAACATCCAGGTTTGTAGGTGCCCCGGCTATTTTTTTCAGAAGTTTACAAGAAACTCCGGGGAAAAGCGGGTCCCCTAACGACTGAAATTGCACAAGCCTCC
ATGTCTGTAAAAGAACGACCCGGGCGCGCGCGCGACACAGAGGGAGGGCATAGGAGGCGAGGAGGCACCACAAACAACCGCGAGTATCTCCTATTTCTTATTGCAAAGTGGGGTCGACCG
TTTTACATGAAGGAGCACTATAAAAAAATCACGCACGTGCCGTGCGAATAGTTCTTATTATCTAGACCAAACAGCGGGATTGAAATGCCGAGCGGCCCGCTACAGAACTACAGCAGCACT
GCAGTACACACTGCGATCTTTGTAGCATCGTCATCATCATCAGCAAACAACAGATCAGCGGTTTGCCGTTTTCTTCCCTCGGCGAAAAGATACATAGTGCCACTTTCGTATGCATTATCA
TGTTGATGTTTTCAGATGTTGTCTGTTTGTGATCGTCCTTGACAACAGAGCGGAGGCGAGTCGACCGTGCCCGCCCTATTTCTTTCACACCCACCCGGCGAACGTCTGATAGAGAGAAAA
GTACCGACTCAACGAAGTACTACCACCGGAGGACCTATGCAACCGCTTTGCAATGCTAAAGGGGGACAATTTCTTGACGTTCGTGGACCAGCAACTGTTGCTATTTTGTTCTGGTCTGTG
ACCTACCAATCGGTCCCCGCATCAAGAAAAATATTAGATTCACCCACGGGGAAGCACCGGAGCCATGCACCCACACCTCGGCAGTCCCGCCTATACAGGCATGAGCACCGTTTCCCACCC
AAGAATGACCTAGGCCTACTCGAGGCCCAGCAACCTAGCACCTACCCTCGCCAGGACCAACCCAGCACCTATCCAAGCAGCGGTAACAACCTAGATTTATCGCATCAACGACAACCTAGC
ACCTATCCAAGCCTACCAACCTAGAAATTATCCCATCAACACCAACCTAGTGCCAATGCCGGCACACCAACCTAGAACTTAGCCACCCAGCGCCAACCTAGCATCCATCGGGTGGGTTTG
GGGGGTTAGCGTTAGGGATTTTGGCCGGTTTCCTGCCCGTGCCAAAGCAGGGGTTCTGTTTTGTTTAGCAGTAACAAAATCGCCTCGGTTGTAATCTACTGGTTACTGGTTGAAGGGATA
GAACCTTGAGTGTGGAACAGGGCGTAACAAGAGGCCTCTGACCACTTTGCACTTTTATTTTCCTCTAGGGATTGTTTTTGGTCTGTCAAGGTTGTGGGTGCATGGCGTTTTTGCCTCCCT
GTGGGTGCATAAAATGTTTTGGCCGCATCCACGACTTTTTCAGGCTGAGTAATTTACGACGTCACTTTGAACAGATAACACTGACACTAAGACAGAACGTGCTCACTGTCAGCGCATGCA
CTCTATTATTTTCGTACATGCTCAGTATTTCCTTTCCGTTGATGCCAATCGTTTGAAACGAACCAAGATACGAAGTTTTTCCGCCGTGCGCGGACGCAAACACGCGTAACGGGAAGAGGC
ACGGATGTTGCATTACCTGGTGACAAGCGAATGACACCGTGGCAGAGCACCAGCAGCAGCGTAGAAATATGCATAGCATCGTGACAGATAGATGCATCAGGTTCACAACTTACCCGCCAC
ACTCAATCGCCTCAAGCCTGCCGATTTTCTCGGGGAGTGAAAGCAAGCAGTGTACAATATTTCCCGCAGGTAGCACAGAAACAAGCCGGTGATGGAGGGCATCAATTTCACCAAGAGAGA
CTCAACAGCAGCAACAGTAGGCAGACGACTTTGCCTCAATTCACGTTTGTCTTCGAAGACAGTCAGTAGCGTGGCGGCGTAAGAAACCTGAACCGATCCCAGACATCCACCCTGAGAACG
CACAGCAGGAGACCCTCACGCCCTCGAAGGTTTCTCTCGATGGTGGGTGCGCTCTCGGCTTGGAAAGTTGTGCGGTTTGAGCAGTTAGTTGGACTCACACAACAATAAACTTACCGTCAG
GTTACACATGGCGCATGGATATACCCACGGCCCGCAGGTCGTATACGCTCGTCTCCTTCCCTGCTGTTTTTGATAGCCGGCCTCGGATCTGTAGGGGATAAACGTGCATAAGTCTCAGCG
GTGTTTGTTGCTGATTGTTGTCTCTGTTTCTCTTGGCTTAAATTCGCACGTGGTCTCCGCTTTATGTTCCCCCTTTACCTCGATAACTCGTGGGGTAAGGGTGAGGTGTTTCCTTCGATT
TGTTCGGGACAACTGCCTGTGTAGCACGGCCATCTCGAAGCACCGCGAAATCAGTGTGACGAAGAGTGCCCTATTTTTATTCCTCCTCCGAAGCCAGCATATCGCCAATCGGTGCTCTGA
AGATCTTGCTCTGGTTGAAACGGATGGTAATTTCGGTCGCCCATGTAGTCGACTGTGGGCCCCTTCATCGCGTTGGAAGAGGCGGATATTTAAGGCCTGTTTTCCCTCTTGGGATGGAAG
CAAACAATGGTTGCGGTTTCGCCAATCCTCGACTCATTGTAACAAGACTTACCCCCCTAGTTTTGCTGGGCTACAAGTGTAGAGGCCTTCGTTTCTCATAAGCAGCGCCTCACGATATGT
AGCTGTAGGGGCACCCAGATGTCGTGTTTGGTCGAGGCCCCGGTATGACACACTGAAGACTGTTCGCGCACAACTCTAACAGGACACAAGACAGGGCCCAAAACTGTAGCGTTGTGGCTC
CGCGATGCCATATCTTCCTACTACAGCAGTTAATAGTGAGCTCTGCACACTTTATATCGCAAACGTAGGTATGTTTGGTGAGGGCGAGTATCAAACGCAGCTCACCCGCAATTTCAACGG
TGGGCAATCCTAACGGTGGGCTGTCCGATGCAGCTTACCCGTTGCATATCTACGTACCAGATTGTAGCTCATCCGTATTCCGCCAGCCCATCCGCGCACAATGGGCGTTTGTCGCAATTC
CCCCCCCCGCTACAGGTGGTAGTTTCGTTTTTTGGCAGCGGAAGTGATTGTAATTCCGGCTCTTGCAGCCAATTGCAGGCAGCGTATGGCGAGTTGCGGGGGGGGGGTATGGTCCACCCC
TTGCATGCCACGCCTCGTTTCCGTCCATCCCAAACATGATGTCCCAGAAGTGCTGCTCTAGTTTCGATCTGACTGTTATTTCGACCACCCACGCGGTTCCACTTTCATGCGTTTGGTGTT
TTGTCCTACAACGGCAGGGCCCCATCAAGCTCCATGACTATCTCGGGTCCTCCTGGGGGCTGCTTTGCTCGCACCCGGCCGACTTCACGCCGGTGTGCACCACCGAACTTGGGACATGCG
CGAAGCTGAACGTGGAAG
GTTGGTGTCTACTGCTACGAAAGTTGTGCTCTGTGGCCCTTGAATATGTACCACACGTGTGCGGGCCGAGCTTCTGCCGTTTCCGTGCATCTCGTGTCATTT
TTGGTGGCACTATGATCTCGCCGGTTCATGCGTTCTTCCGTGTTTTTTGGGGGTATGGGTTCACGTTATTCTCTCGCCGGTGCAACCGATGTCGTCCGTTGTCCAAAGTTGATCTGCTCT
TCTCGACTGCCTCGTGCCCTTTTACAGTGCAGAGAAGATTGACCTCGGTCTTGCAACGTTCGAGCAAGGGCCGCACGAAACCGTCAGCTCATACGCCCTCCGTTTCCAAAACGAATTTAC
TCGTTTCGAAGACTACCATCAAGTGCCTGTACATGTCTGATAAATCGGGGTGAAATCCATTCGTGAAGCTGTCGATGGCGCTCGCCGCAATGGGACAGCAAATCCTCGCGGGCGGCAACC
CCACTGTCAGCGCCACGCCGTCCACACATGTCTCCAACCGCGCCGCTGTTGCCCAACAGTTTCCTCCTGTAGCGTAGCTCAACCGCAGTTGCTGCGTTTTTCCTGAGTTTTTTTTTTTTT
CCCCGTTTCTTATGTTTCAGGCGGTGAGTTCCCGAAGCGGGATGTGAAGATGTTGGCCATCTCGTGTGATCCGTTGGAGTCGCACCAGGGCTGGATCGGCGACATCAAGGCACACACCGG
CCACGAGGTCAATTTCCCGCTGATTGCGGATGCCGACCGCAG
GTACTAGAAAGAAGAAGAGAAGCACGCTTGCGTATCATATGGTCACGTACCCCCCGCCCCCCACCGTGCTGCAGTGTA
GGGCGAACGCTAGAAAAGCACTAAGAAGAATTGTTATCAGGAGAGTACGTATGGAAAACCGGTGAGAGGGAGACACAGAATGCGATGGATCACCGGAAAGGCGATAGTATGGAAGGAGAT
GGGGGGAGACTATAGAGACATACCTCTCTTCTCAGCGACAACCTCGTTGTTACGTTTGTGCGTGGGGTCCTTCCTCCGGGGTTATAGTGCACATGAGAGTCTTTTTGATGTCGGTCGGTA
TTTTCGATGACGGCAATGCGCTTCGTGAAGTGCTGCGTTATCAACTGTTCAACTAGTTGGGTGGTCCCTTGTTCATGATTTGCCTCGGTGGCATTGCATTCGCTCTTGAGCCTTCACCAC
AACGATACGAGCGTTTTCCACCAAACGGCTGTGGTGACGCATGGGTGCAACAGTTGTCGATGTGTTTCTCTCTCAACCTGCCACCCTCGAAATATGTGTAGCATCGCGGCTTCCCTGGGC
ATGCTGCACCCGGACCACATGAGCGCGGAGGGCCTCCCGATGACGGTTCGCACCGTGTACGTCATCAGCCCCGAGAAGATCCTCAAGCTCGCGCTCACTTACCCGGCTTCCACCGGCAGG
AACTTCGACGAG
GTTTGTTTTGTCGCGACACCATAGCTTTTGTTCTTGAGAGAGGGCTTAACTATGATACAGCAGGTCTGGCGTGGTTGCTAGAGGGGTAGAGGCACCCATGTAGTCCGG
TGGCATTGATTGGTGGTGTAGGTAGCTTTTGCGACGAAAAGTTTTCCTGGGTGCGTTAGAACTTGTTTTTTGTCTTCTGACCGACTACTCGGTCCCAGAGAGATATGACTAATATATAGT
AAAATCAGTTATAGCAGCAGCCGGAGCGCAACTCTGTGACAACATTTTTGAACGCGCTTCGATTCGCGGTTAGATTGAGAGCTATACGTAGAGACGTGGAGATGTAATCTATGCTGTCGT
CCCTCTTATGTTGTCGTCCCTCTTTAGCGTGGGGAGATAGACTGATTTTCCTCCCAGAACTGCTGCAGCAACAGGTATCTCACACCACTGGGAGATGAAAAACACGCACCCGTCTGACAG
CAGTCAGTCCTCCTCCTTCAACGTCGCCAACCTCGGTGCACCTCTGTACATAGATCATTCGGGCGATCGACTCCCTACAGCTCACGGCCACCCGCAGCCTGGCCACCCCAGCCGACTGGC
AGAAGGGCGGCAGTTGCATGGTTCTGCCCACGGTCAGCCCCGAAGATGCGGCTGAAAAGTTCCCCGAG
GTATGCGTACACTGTACTTCGATTTTGTCTTTTGTACAAGATTAAAAAAATC
AGCACTTTTTGAGGCTGCCATGAGTGGATCACGCCACATGTGCAGTATGATGCCATCACCACTATGGTCATCCACCCAGACAACTATTAACAGTAGGGCCAAGCAAGTAACATTCACTCT
CCGTCATGCGCAGATGAACAGAAGTTCCGTGCCAGATGCCATGCAGCTTGAGAGAAATTTCGCCAGCGGTTTAGGGTTCATCTTGCGTCTGGATATTAGCGCCGCGTATTTACCCCCTCC
CGCCTCCCCCCCCTCGTGATTCCGCGTGTTTCTCTCCAGCACAAGACGATGGAAGTGCCCTCGGGCAAAGGGTACCTGAGGGTTACCCCCACGTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCGACCCCGTTGCCCTTCTCCTCGGCGACAAGTTCCCTGATTTCGAGGCAGAGACGACGGCGGGCCCCATCAAGCTCCATGACTATCTCGGGTCCTCCTGGGGGCTGCTTTGC
TCGCACCCGGCCGACTTCACGCCGGTGTGCACCACCGAACTTGGGACATGCGCGAAGCTGAACGTGGAAG
GCGGTGAGTTCCCGAAGCGGGATGTGAAGATGTTGGCCATCTCGTGTGAT
CCGTTGGAGTCGCACCAGGGCTGGATCGGCGACATCAAGGCACACACCGGCCACGAGGTCAATTTCCCGCTGATTGCGGATGCCGACCGCAG
CATCGCGGCTTCCCTGGGCATGCTGCAC
CCGGACCACATGAGCGCGGAGGGCCTCCCGATGACGGTTCGCACCGTGTACGTCATCAGCCCCGAGAAGATCCTCAAGCTCGCGCTCACTTACCCGGCTTCCACCGGCAGGAACTTCGAC
GAG
ATCATTCGGGCGATCGACTCCCTACAGCTCACGGCCACCCGCAGCCTGGCCACCCCAGCCGACTGGCAGAAGGGCGGCAGTTGCATGGTTCTGCCCACGGTCAGCCCCGAAGATGCG
GCTGAAAAGTTCCCCGAG
CACAAGACGATGGAAGTGCCCTCGGGCAAAGGGTACCTGAGGGTTACCCCCACGTCGTGA

Retrieve as FASTA