Entry information : Esil2CysPrx01(Esi_0075_0079)
Entry ID 16927
Creation 2021-01-29 (Christophe Dunand)
Last sequence changes 2021-01-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2021-01-29 (Christophe Dunand)
Peroxidase information: Esil2CysPrx01(Esi_0075_0079)
Name Esil2CysPrx01(Esi_0075_0079)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Esil2CysPrx01
start..stop
S start..stop
Hpar2CysPrx01 346 6.61e-118 67..382 64..380
Pi2CysPrx01 344 4.68e-117 62..382 58..376
Cint2CysPrx 258 4.04e-86 71..263 3..195
Cel2CysPrx02 258 6.86e-86 74..262 4..192
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '16927' 'join(474764..474819,475498..475644,476418..476553,477433..477510,478051..478136,479274..479394,480072..480161,480675..480785,481261..481339,482405..482506,482769..482923)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 474764..474819 54 N° 2 475498..475644 145 N° 3 476418..476553 134 N° 4 477433..477510 76
N° 5 478051..478136 84 N° 6 479274..479394 119 N° 7 480072..480161 88 N° 8 480675..480785 109
N° 9 481261..481339 77 N° 10 482405..482506 100 N° 11 482769..482923 153  
join(474764..474819,475498..475644,476418..476553,477433..477510,478051..478136, 479274..479394,480072..480161,480675..480785,481261..481339,482405..482506,48276 9..482923)


exon

Literature and cross-references Esil2CysPrx01(Esi_0075_0079)
Protein ref. GenBank:   CBJ27588.1
DNA ref. GenBank:   FN648981.1 (474764..482923)
Protein sequence: Esil2CysPrx01(Esi_0075_0079)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   386
PWM (Da):   %s   41773.29  
PI (pH):   %s   5.09
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MISTLRRAGTRAGRAVGASLAGRPAAAAAPSVTATWRDASPRSTASPVIGGPIAPARAMHTEQEASIFYPAPSANIMEPAPGFKAKAVVDGDIVDVSTDDYKGKWVVLLFYPDWTFVCPT
EIIAFSDRHSEFEALGAQ
VLGISTDTEDSHLAWTRHPRKRGGLGHMRIPLVADPTKEISADYGVLIPSLGIALRGLFIINPEGILEVTINNLGIGRDVDETLRLIQAHQFLAKHGEVCPA
GWKPGDKTMKPGLDASMEYFSSGATESEEDPLE
AGDKMVVINSPNDFKDVTSEALAVVDFVAPHCGKCRQMMPFVKELSEEFPEVTFAKFDTTEEAISELSTDLGVEALPAFRFYRKGEE
VVEPVMGYKKKKLRAAVEELQKKA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTAGTACACTTCGTCGGGCTGGAACCAGGGCCGGGCGTGCAGTGGGGGCCAGAGGTGAAGAAATAGTGTTGATTGAAGTGTTATTATGGGGGCGGGGTATTTCCCTCGTCTGCTGG
CTGATACGTTCCACGTTCCACCGCAACAACGGATGCCTGGCACTCTCGAAAACATGTCACAACCGCCCTGTGCACCACAGCTGACGAATTCAAGCAGAGAAGATGGGGTGGATCAGCGAG
CGTCCACCGCACGAGATCGTAGCTTGTCGCACGAGCTCGAATCTTGAACGCAAGATGCACGTGTCGTGGTATACCAATGTGCGGTATCTTCTCTCTGACAATATTCAATATTGTACTGAA
GGATACTTGACCAGTTCAGCCCCATAGGCCACCCAAGCCACGCGTGTATGCATAATACTGCAAGTAGGCGAAGTATCACACGCAAAAACTTGCACGCGCTCATGTGTGGAGGGGTTTTCT
TGATATGGTGCGTATTCCTGCTTGCCGGGAGCTTGTTTTTTTTTTTACCCGTGTGCGGGTGCGGGGTAGCAACGCGATGGCTGCAGCGTAGTACCTGTTGTACCAGAGGGTCCTAACAAT
GCATCATTGTTTCGAAAAGGGTAGCATCGAATTCACCTCCTGTATACGAACTCATCTTTTTTTCACGTTATCTTTCGGATCCGCCCCCTCCCCCGTCCATTTCCATTTCTCTCTATTTCC
CGGTCCGATTACATAGCCTTGCGGGGCGCCCGGCCGCTGCCGCCGCTCCCTCCGTCACAGCAACTTGGCGGGATGCCTCACCCAGGTCAACTGCCTCTCCGGTGATCGGGGGTCCCATAG
CTCCCGCTAGGGCGATGCACACGGAGCAGGAAGCCTCCATCTT
TTGTGAGTGGAGATTGAGCTGAACGCACACACACTTGAAGACGCGAACATTGTCGTGCGGTCAGCGCTCCTCTTTTC
TTCTTCACGGCCGTTTCGGTCTCATCCGCTTATCTCGACGGCCCCGGAATTTGTTAACGACAAGCTCCCCCTACCGTGGCCGAGATTTTACAACCCGTATACACCGTCCTTTTGATGAAC
ACAGATGTTTCGATGATTCTATCGTGTCGACAGCTCGAGAATGCATCTCGCGGCCGTGTGCTGCTACTGTAGCTGTTGTTGGGTCGGTCGTCTGCCAAGCATTGCCTGATACAAGCTTTT
GCACCTCATGGTACAATATGTGGCCATCTCCTTCCGCGCTGCTCTCTCTCACTCTTGTCATCCGACAGACTGCGCATTGATAGTCCTCCCCTCATCAAAACTTTCCCGTTCATGCTGCAT
CCATCGGTTTGCGTGTTTACAGGCGTCTCGCCCCCTTGCTCCACATCGTAGTCGGGATGCTTGATCCCCGTTCTCGTTATTTTCGCAAGCCGCACCGCTGTAAATGCGTTAGGGTTCCCG
GTTGCCCCCGACTCATGGCTTCGGTACTCGCAGAACCTTGACGCAGCGCCCCCTCCCGAGTTTCTTGGTTCAGCACCCAACAAGCCACCTCTGAAACATTGTTCTTTTCGGCGTTTAGCA
CGTCACAACCCGATTTCTCCAGCGCTACGCTCATCTGCAATGGATACCGGCCACTTTCCGCTCCCCGTCCCGCCCCTCGGCCCTGTGCTCACGCGCAGCTACCCCGCCCCCTCCGCCAAC
ATCATGGAGCCGGCACCTGGGTTCAAGGCCAAGGCGGTGGTCGACGGCGACATCGTCGACGTCAGCACGGACGACTACAAGGGAAAGTGGGTCGTTCTCCTCTTCTACCCGAAG
AGGTAA
TATATATATCAACGGACGGACACAGACACCCGTTCGGTTGTCGGGGTAGGTAGATTTTTGGTTAAGGGCTCGAGCGTTTGGTTGTTCGATCACCGGCTCGGTGGCGATCTGAAGTTGGGG
GCACAGGCGATGGTACATTTTGCATACGGGGAGGGGGGCTCCGTCTCGCCTTCTTGCTAGATCCTGAACTGAACGTGCAGTTCTTTCGTCATTGAAATGAGGCCGGGGTTAGGCGACTTG
CGGGCAAGGAATCAGCTCAGGCCATTTTCTCGAAGCGGTAGTCGAGAGCAGGGGGGTGAACATGGATGGTATTATACCATGAACAGGTGTGCCGGTCGTATGCTCCTCGTGTCGCTCTCC
AAGGCGACCCTACTATGTGCCGATACTGGCATTCTCTTGAACAGGGCGTGTGGCTTGGTGCTGTGTGATTGGAGCCAACGTTTGGCTACGCTCTCGACGCTTTCAAGCATAGGGTTTGCG
ACGATGTTGGAGAAATTTAAATATTCCCGTTAAGATTCAGGTCGTGGTGAGATTTCGCAGACGGAGTCAGAACCTTGTGTGGTGCACTGTTGCTTTGAAGTAAGACGCCCTGCTGTAGTC
AAACCGCGGCCGGTGCTAGCCTCATCGTGCTGTCCTCGGTTGCTGTGGTTCGACTGATGCTGCGTAGTCGGTCGGTCGGTCGGTCGGCGCTGGATAAGCCTTTCCTTGAAACGTAAGGTT
TATCTGTCCGAATAGATCGGTTCTTGTGTGAAGGGAACAGTTATGTGAAGGGAAACTAGCAGCGTGTACAAACGACAAGCCACAGGCCGCTGCTGTAATTCAACTTTGCTTTCGTTGTCT
TCGATTCATGTTCAAATTTTGTTGTTCTTCTGCAGGACTGGACGTTCGTGTGCCCGACGGAGATCATCGCCTTTTCTGACAGACACTCGGAATTCGAGGCCCTGGGTGCACAGAGGTAAA
AATGCAAACACAAACCCGAGGTTATTGTAGACAGACGCCTCCTAGACCCGCTTGGCTTGCAGTTGCGTCTCTGTGTGTCCTGTGGCCTTCTTTGGGCCAAGGCCAGCAAGGAACTGAACG
TGTTCCTGTCTTTCCGTGGTAACCCCGCTTGGCGTCACCGAAGGGTCGTGAGCGACGGTCAACAGACGATACCCTTTGCCCGGCACGCAAAACGAAAGGATGATGACAAGCTTCTGGTTC
ATGCTTGTAAAACGTATCCGGGGCCGGCGAAAACTCGGCATATCACTCCGTCCCGGCGTTGTAAGGATACGAGGTCAATGGTCTGCGGACTACGACTTCGTTTACATGGATGGGAGCGAA
TAGTGCAGCTATTGGGGGCATCATATCATAGTTTCTACTTCTCACTCCCCCAATACGACGGCGCGCCGTGCATCCGCAAGGCGTAACGAATTTGTTCCGTGGTCGGTTGCTGGAGGTCCT
GACTGCTTTATTGTGCCCTTTTTGGAACCGGACGCGCTGTGCGTGTTGCATGAAGGTCCTGGGGATCTCGACGGACACCGAGGACAGCCACCTCGCGTGGACGCGTCACCCCCGAAAGAG
GGGAGGGCTGGGGCACATGAG
AGGTGCGCGTAATTTGTACCACGTGCCACTCATCCTCCAGTATTCACTCAATGGCTGGTTGTCTGCATGTTGAGAGACTGACCCTAACCCTCTGTCCAG
CACCCCCCTCTTCCCTCGGTCTCACAAAGAAAAGTTCGAGCATCGGCGGCCACAGGTAAATTTAGCCTACCAAGGTGAACATATCAAACATATTGTGCCGGCGTCTTCACTTAGCCATTC
CTGTTACTATTATTGCTCTTGACCTAAGAACAGTTAATGAAAGTATCGGATTTTGGATGAGGCCTCCAGCTTGGAGGCCGGAGGTCCAACCCAGACCTTCACGCCCGCAAGTGGAACAAC
CACGGGCGCTCTACATTGAGCACGGTGCTGGACTAGGTGCCCCGCCATGGCGGGAGAGGGGTAAACAGAGGCCAAGCGCTGGTACGGTAAAAGTGCTACCACGTTTGGCGCAGAGACGTC
TCCACCGGCGGACCCAGCACAATGGCACCGCCGCGAAGAAGATGATCGGAGTCCCACCCAGGAGGGTGGCGATCGCTGTGCGGACGACCTGCACGCAGTTATGTCGATGTCGAGCGGGTC
AGCATACTCCCGATGACGACCTCCAGAACGCGGTAGGCGCCAACCGGATGATGATCTTCCGCTAGTAGGGCCGTGGGATGGCATCGGCCACGCTGTTCGCCGCCGTTTGGAGGAGCCCAC
GTACAGTAGTCAGGGAGGAAGAGGAAGGCATTCTCTACCTGGAGGTCAAACAAGCGGATATTCATGTCGTGCATATGGTACGGTTCTTCGCCCGCCGCCCGCGGTCGAAGGAGACCAGTT
GCCCGAGACCCGCAGCCTGCAGCCGGTCCGCAGGCGGTAGATTTCGACGGGCGCTGGTGCTGCGGCTGACGCTGGTGGCGCGGTCGGCGTCGGATTGGCCCGAGTTCCTGAAACCTCTCT
GTTTTTTGTTTTCTCCAATGTTCTCGCGTGTTCACGGTGGGGAGAAAGACATTGACCAGCTGTATGTGATATATCAAAATGCTATCGGGGCTGCCGCCTGCATCCAATTTCGTGCCTAAA
TTGTTTATTTCGTTTGTGTGGACCCGACTTTGCTCGTGGGTCTGCCCCCCCCCCGCGGCATCCGATCTTGTGCCTTGCAGGATCCCCCTTGTCGCCGACCCCACGAAGGAGATTTCGGCG
GACTACGGGGTGCTGATCCCGTCTCTCGGGATCGCTCTCAGGGGGCTCTTCATTATCAACCCCGAGGGCATTCTCGAACAG
AGGCGAGCTCGTCGGTGTCGCCGGAATTTCTGTCGCCGC
GTGTGGTGTGTAGCAGGTGTTGTCGAAGGAACATGACCCTTACCAACTCGCGGAACTGTGGATGTGGTCATTCCTTGTTTGTCAAAATGTGATGACCAAGTTTGTGCACGTGCAGCAACC
CGTGCCTTTATTGTGCCTGTAGGAGCGAAGTGAACTTTGGTGATTCGACAGGGGCTCGTGGTCTGCAGGCGTACTGAATTCGGAATCCGTTGAACTCCTAGCGGAAAATCGTTCGGAATC
GGAATAAAACAACCTTGTGTTCTCATACTGAACAAAGAATTAACCCATCGCCACTATTCGTCCTATTTTAGACCCGGCTCGAACACCGCAATTGCATTGGTACTCTATCGACGGTGCCTA
GGTTTCCGCCGGCCTGATACCAAGTGTTCACCTTTTCCGGATCCTGTTTCTCGCACGTACTGCTTGGACGCGGCTTTCGCTTTCCTGAGATGGCGTGTGCTCTGTGGATGGCTCTTCGGA
GGCTCCGGCCCACCATCGCCAAACATTTTTTTCCCGCAACCCCGCCGCAACCTTGACATAAATCACTCTCATGCTGGGCTACCAATATCCCTCTCTTCCGCACCCTAACGCGATCTTGGC
TCCTATCACTGCACCACAAACGTTGGTCCGAACGCTTTAGGTGACGATTAACAACCTGGGCATCGGCAGGGATGTGGATGAGACTCTTCGACTAATCCAGGCACACCAGTTCCTGGCAAA
GCACGGCGAG
AGGTAGGGGTGTGGGTGGGCAGATGGATAGCGAGGTAACTTGAGCTACAATTTGTGCGACATGAGGGCATCTTAACTCGTGTTGTTGTCGCCCTTTGCCAATGGAGTCAT
GTTGATACAATGATGCATGCGCCTATCTGGAGAGTCTCGAAGCAAATCGTTGGTGTTTTTTTCAACAACCGTTGTGGCTATGAATGATCGGATCTGCTGCTTCCAGCGCAGCAACTTTGT
GTTCCAAGTACACTAAATACTTCTTCTGTCGCCCTTTTTCCCTCCCATTCTCTCTCGCAGCGAGTGATGGGCTTCAGGCGAGCCCAGGGCTATCAATGTTACGGTTGTCAATATGGATAT
CCGAAACCCAACAGTGATGTACTGGAATCATCTTTGCAAGATTGTGTGGCCGCAACGACCGTCACCAGCGTCGCGATAGACTGACCCTTCCTCGCCTCGGACGTCCCTCCTCTGACGCTC
CTCCTGCAACGATTCGAACGAAACGACCATTACGGCCGCGTTCAGGTGTGCCCGGCCGGGTGGAAGCCGGGAGACAAGACGATGAAGCCCGGCTTGGACGCGTCCATGGAGTACTTCTCC
TCCGGCGCGACGGAGAGCGAGGAAGACCCGCTTGAG
AGGTATTGGACGGCCTGCGTTTTTTTTTTTTATGTTTTTGTGTCCATGCTGCATCCGCCGCTGGGTTTGCGGTGTTTCGTGCCG
GCGTTGTTCTCGCTGCGGGTGGTCTTTTTGCAGCGTTTTTGTCGTTCCCGCTTTTTCTTGTCCTGTTCTGCTGGAGTAGGTGCAATACTCTGCAACCTCTGTGCGGGTCGTGGGGTTGGT
GTGACAATGGCGAGCGAGAAATCCCGGGCAATCGGACGTATTATTTCTCCCGTCTGGTACCATCCACCTCGTTGATTCGCGCTGCTGTTTCACTCTTGCCGTTATTTTGCACTCAAAAGA
CGCCCTCTTTTCACCGAAACCGCAATAAAATGGCTTGTCGGTTACGCCCAACTCTAGGCTCTTGTGTATCTCCCAACCCTCCGTCTCACGGCACGCTCTCTTACGAACACGGCTTTCGCC
TTGCACGCGCCGCTGTGGACCCCGGTGCTCTAGGCTGGTGACAAGATGGTGGTGATCAACTCCCCGAACGACTTCAAGGACGTCACCTCCGAGGCTCTTGCCGTTGTCGACTCTGTGAGT
ATGGCGGGCGGGCGGCTGTTCATTGCCGACGGGTAGCGGTCGAAGCGGGTGTTGGAACGGTGGCGTTTTCCCCGCAATGCTCGAGATCATGAGTTATACCACCCCCTGCAACGGTTTCAA
TCGTGGAAGACGTTGACCGTTGTGGACTGCGAGTTTAAGACGGAGACCTGCCACGACCAGTCGGTGGGGCCGTGCATCAGTTTGCAGCTGCTGGGGCGCGCGTGCCACAATTTCCCTGAT
TCCTCCGCCGCTCGTTGTGTCTTACCGCATTACCTTTGGCGTTCTTCTGAGGAGCTACCGCTCCATGGTTTCGCAGAACGTTCACTCTCTGCTGTTTTGAGTATGAACGCTAGGAGATGG
GAAGTTTCACTCTGCGCTGTTGCTGTGAACATCGGCACTATGAGATTCACTGGTTCCCTCGGCAATAATCGAATCGTGTTGTTTGAACAGCAACCACTTCCGACATGGCGCCACGATGGA
GTCAGGTTTTGTATTCTCACGTGCTGGCATTCTTCGGTCAGTGCGCACGTGTGAAGCAAGTGATGCGTATTCACGATAAATCGCTTTCTATTGATACACTGTGGCGAAGGAAGATGGAAA
CACGCGGCGGTCACAGAATTCGTCATTATCCATTGTACGCGACACGGTGTCCTACTGCCGCACTAAACCCTTAAAGAGAATACCCGGAAGGACGTACACGCCAACTCCCCGAGGGGGATT
CCTCGTTGTCGACTGTGGTGCGAATTGATGATCCTGCTAAACCATTGCCACAACCATCCATTGTTCGGGCAATGCTGATGCCACCGGTGGTTCTGCGCACCTCGTTGGAGTTGGACCCCC
CCCCCGAATACAGCAAGGATCTGAGATGCCCACTCATGTCCATGATATGCTTTGTCATCCGTTGCTGTGTTTTGTCGTTCGTGTTGCCCTGTTGACTCGAGTGCACGTGAGCGCGATTCT
GCGCACGGGGTCCAGTTGCACGTGTGGCTGCGGTAACTGACATGCTTCCCCTTACTTTCCATGTTCGCTATTTCCGCGGAATGTTGACTCATCCATTAGTCGTGGCACCGCACTGTGGCA
AGTGCCGTCAGATGATGCCGTTCGTCAAGGAGCTCAGCGAGGAGTTCCCAGAAGTCACGTTCGCCAAGTTCGACACCACCG
CGGTGAGATGGGTCATCGTTGAGTTGGTATTATCGTCGT
TGTCGTCGTCGTCGGCGGCGGCCGCGGCGTTGCTGTTTCGTGTTTTGTGGGGGGTTGGTGTTGGTGTTGATGCTACTGTGGGTGCTGCAGTTGTTAGTGTTGTTGTGTTGATGGTTTGTT
GGTTGAGCTACGCACCGCAGAACGGGGGCTTCTTGTTTACTCGGCTTCTGATCTTTCGTCGTCCTTCTCCTCCTGTGGCTGTTGTATGACCTGCCTGGTCATCAGAGGAGGCGATATCAG
AGCTCTCCACGGACCTGGGGGTGGAAGCCCTGCCGGCTTTCCGGTTCTACAGGAAAGGGGAAGAGGTCGTGGAGCCTGTGATGGGCTACAAGAAGAAGAAGCTCCGAGCTGCCGTTGAGG
AGTTGCAGAAGAAGGCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTAGTACACTTCGTCGGGCTGGAACCAGGGCCGGGCGTGCAGTGGGGGCCAGCCTTGCGGGGCGCCCGGCCGCTGCCGCCGCTCCCTCCGTCACAGCAACTTGGCGGGATGCCTCA
CCCAGGTCAACTGCCTCTCCGGTGATCGGGGGTCCCATAGCTCCCGCTAGGGCGATGCACACGGAGCAGGAAGCCTCCATCTT
CTACCCCGCCCCCTCCGCCAACATCATGGAGCCGGCA
CCTGGGTTCAAGGCCAAGGCGGTGGTCGACGGCGACATCGTCGACGTCAGCACGGACGACTACAAGGGAAAGTGGGTCGTTCTCCTCTTCTACCCGAAG
GACTGGACGTTCGTGTGCCCG
ACGGAGATCATCGCCTTTTCTGACAGACACTCGGAATTCGAGGCCCTGGGTGCACAG
GTCCTGGGGATCTCGACGGACACCGAGGACAGCCACCTCGCGTGGACGCGTCACCCCCGAAAG
AGGGGAGGGCTGGGGCACATGAG
GATCCCCCTTGTCGCCGACCCCACGAAGGAGATTTCGGCGGACTACGGGGTGCTGATCCCGTCTCTCGGGATCGCTCTCAGGGGGCTCTTCATTATC
AACCCCGAGGGCATTCTCGAACAG
GTGACGATTAACAACCTGGGCATCGGCAGGGATGTGGATGAGACTCTTCGACTAATCCAGGCACACCAGTTCCTGGCAAAGCACGGCGAGGTGTGC
CCGGCCGGGTGGAAGCCGGGAGACAAGACGATGAAGCCCGGCTTGGACGCGTCCATGGAGTACTTCTCCTCCGGCGCGACGGAGAGCGAGGAAGACCCGCTTGAG
GCTGGTGACAAGATG
GTGGTGATCAACTCCCCGAACGACTTCAAGGACGTCACCTCCGAGGCTCTTGCCGTTGTCGACT
TCGTGGCACCGCACTGTGGCAAGTGCCGTCAGATGATGCCGTTCGTCAAGGAGCTC
AGCGAGGAGTTCCCAGAAGTCACGTTCGCCAAGTTCGACACCACCG
AGGAGGCGATATCAGAGCTCTCCACGGACCTGGGGGTGGAAGCCCTGCCGGCTTTCCGGTTCTACAGGAAAGGG
GAAGAGGTCGTGGAGCCTGTGATGGGCTACAAGAAGAAGAAGCTCCGAGCTGCCGTTGAGGAGTTGCAGAAGAAGGCGTAG

Retrieve as FASTA