Entry information : EsilPrxII02 (Esi_0130_0046)
Entry ID 16928
Creation 2021-01-29 (Christophe Dunand)
Last sequence changes 2021-01-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: EsilPrxII02 (Esi_0130_0046)
Name (synonym) EsilPrxII02 (Esi_0130_0046)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value EsilPrxII02
start..stop
S start..stop
VvPrxII05 147 1e-44 14..162 39..189
SrPrxII05 145 2e-44 25..178 1..156
MtPrxII05 145 1e-43 25..162 55..194
SbPrxII01 143 1e-42 27..162 70..210
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 233828..233943 116 N° 2 235477..235636 160 N° 3 236346..236471 126 N° 4 236856..237125 270
N° 5 238367..238372 6  
join(233828..233943,235477..235636,236346..236471,236856..237125,238367..238372)


exon

Literature and cross-references EsilPrxII02 (Esi_0130_0046)
Protein ref. GenBank:   CBJ29011.1
Protein sequence: EsilPrxII02 (Esi_0130_0046)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   225
PWM (Da):   %s   23558.06  
PI (pH):   %s   5.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDTADVCRGEQSTPGWVRLAQRNLARVRVGDRLPDSIVRRLDDDGIVKEFSIRDVFAGKKGVLVGVPGAFTPTCSAVHLPEFVDKSGVLAAGAELVAFISVNDAYVMKAWEDSQQAKDKVLMLADGNGDLSAALGMMVDLSAQGMGPRCKRFLCVVEDGVVTHTRMGDTVELVSASAVEKVLSGTDGGERGPRKGGLFEKLLGREVEARAAEAGASGSGGLLPA*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATACGGCCGACGTGTGCCGCGGGGAGCAATCAACGCCAGGATGGGTGCGCCTCGCTCAAAGAAACTTGGCGCGCGTCCGTGTCGGCGATCGGCTTCCCGATTCGATCGTGAGGTAA
GCTTTAGGCTACAAACATGTGCACTCCACGTACGCGGCTAACAGCGTTCGTTATACGCAGTTGCTGATGGTACGCCGGTCGCTGCACCAAGCGCATCCAAGGCCTAGGGGAGAGACACAA
GTAGGAGTGCGTAGCGCTCCCTCCTGCAGGTTGATCTTGGTTGTGTCTGTCTGTATTCCGCTTCACGGCGGCCTCCGCCCAGAATAGGTTCGTGTCCCGTGTGCACGGAGAATCAGCAGG
TGGTGACGTACCTCTGGAGCAAGCAGACTATTGGCCGAAAAGAAGGTTTGCGTGTCTGTTCTATTATACGCGTAACACCGCGAGTACGTAGACAGGTGCTTGCACCTTGTTCCACTCGTG
TCAGAAGTAGTGTTCCAAGGCCTGGCAAATATGAGCAGAGAAAGTGCACCATGATCCCGTTACCCCCCAGTTGAAATACAGCAGTACACGCAAAGAAAAAAAATGCACCTCCTGGGTGTG
ACCGTGCTGCTGACACCGCGAGGTGTCATCACAAATACTGACGACTCCCCAAGGATATAGTGACTTCTGTACATACAGCTGTAGTGTCGTTCGGGGGCTGGCAACGCGTACACCTCCAAT
CTTAGTTTCTTATGCACGTGGCTGATTCAGCCTGCTCTACAAACACGCCATTTAGAATGTATACATAATCTAACAGAAATACTACATACGCCCGTTCGAGAGAATACGCAGTACCGCAGT
CTTTCTTTTGTGCAGTTTCGTTTGTGCCCAGGTTTGGTGCTATTACTTGAAGTCTCGGACGGAGAACCTCCGGCATTAGGGGGGGGTCGAACGTACGGCGTACACGACCGAAAAGGACAG
CACGATTATTCGCTACTTTACCTTTCCTGAGCTCTGTATTTCCAGCTGGGGTAGTTGATTTGCGGTAGAGCAAGAGTGCAATTCTCCACCCGCGAGTTTTGTAAGACACCCGACCGGGAA
ACACATGCAGTACAAAAGCAGCAGGAAATCCAAAAAGGGGTAAAATAAGAAAGTTCAGTCACATCGCGTGTTTGGCAAACCGGTCAGTCCCCGTGCTAGGAAAAGCCGTGATCCCCTCAT
TTACGAACGAATGAAGGACGGAGCGGATGATATCTTGGGGGGAGGTCCACCGGGGTGCTGCCGGTTTTCGTGTGTGCGCCAAGGCAAGCTATTATGTGTACGTCGGGCGATGACACCAAC
ACGACTGCATACGAAACATGAGTTTCCTCGAACACAAAAGTCTGTAGATTACTATGTACGTCAAACTTGCGACAATAGGGGCCCTTTTTGAAGAGTACACATTACACTCAAGGAACTCAG
ATGCATGTGTTGACCCCCTTGCAGCGATGAACGTTGCGTGGCCGGCAAATATAATACCTGTCCGACAACAAAGGTCAGTCCACCAACAGCAAAGGTCTGTCCAACCACAGCAAAAGTCAG
CGAGAGTAACTGCTGTACACCAGCTGGTTCACGTGGGTGGACTCGTTGTTGAAACCCTGGACTTTTTGTTCTTTCTGGCGTTCGTTCAGGCGTCTCGACGATGACGGCATCGTGAAGGAG
TTTTCGATCAGAGACGTCTTCGCCGGAAAGAAAGGAGTTCTAGTAGGCGTTCCGGGGGCGTTCACGCCCACCTGTTCGGCCGTCCATCTCCCCGAGTTCGTGGACAAGTCGGGAGTGCTC
GCCGCGAAG
GTATGTTCCGCGTTGTTGGTTGCGGAAGATACCACACCCGGTAGACCGTTTTTTCCGGCCAGATGACGGAAGATGATGTCCATGTATCGAATGGTGCGTTTTGGGAAAGCT
CTCGACAAGACGGTTCCGACACCGCCATGTTTGGCACGATCATTGCTGTGCCTGTAGCGGAGTATTCGAGCTTTGAGAATCGGTCCAGGGGGGGGGGGGTGGTATCTTCTGCAACCTACG
GCTTTTTTGTGTACCGTAAGAGTGCGAGTCATCGCACTTCCCTTTGCCCTGATGTCACAGTTTGCTCCATTGCTCCATCATGATCAAAAGCAGTTAGCAATGATGAGGCAAGGCGCTTTC
AAATGATCCCGTCGAAAGTTTTCCTCACACGCGTCGTTCGGTGTTCGCACCCTCGCCCAAAGGGAGGAGAAAAAACTGTATTGAACGGAAGTAGTCACGACTGCCTCAGACGAGCGATCG
GCCTGTTCGGTGCTGCTGGCTTGGGATCTTCTTTGTTTTTTTTAGTCGTGGTGACTGAATGTCCGTTCGATTCTTCCGTATGGAGTGCGGGGTATCCCACGATGGTTACAGGCACCAAAC
TCCGGACTCGCTACTACCAGCATATCGCTGTTTCGGCTATAGTTCCCTTCCGAGGCAGCCTCCCCGTGTCGACCGACACACGCGCCCTCATTCCTGCAAAACGGTTGCCTTTGAGCAGGG
TGCCGAGCTCGTGGCGTTCATTTCCGTGAACGATGCGTACGTGATGAAGGCGTGGGAGGACAGCCAGCAGGCTAAGGACAAGGTGCTCATGCTCGCGGACGGCAACGGCGACCTCTCTGC
TGCG
GTAAGGCGGCCAGGACAACGTGTTTGGATGACAGAACCTAGAGCCTCGCCTTGGAGTCTCTACCGCGCGTGCCTTCCCTAGCCTTTAGCTCGCGTCTTGCGCACCTACCATTCCGC
TAGGCAGCCGCCTGCAACTGCTGAGCCGTAGGCGTATAGACCGACAAGTTGCATACCTTGCTAGTGAACGGCTCGTGCTACTGTGCTCTTGTTTGCTGGCAGCGTTTCCTCACGCAGAGC
ATGTCATGGTCTCCCTTGATAAAATAGCTGCTTTTTGTCGGCATCTCACAATGAACGTCTTTCCCCCCCCCTGTCTTCCCCCCTCTCCCCCCCCCCCCCTCCCACCGCACCGCTTGTTTA
TTCCCTCGCACACGACGCGCTTGTGCAGCTGGGCATGATGGTAGACCTCTCGGCGCAGGGCATGGGCCCCCGGTGCAAGCGCTTCCTCTGCGTGGTCGAGGACGGAGTGGTGACGCACAC
CCGGATGGGCGACACGGTGGAGCTGGTCTCGGCCAGCGCGGTGGAGAAGGTGCTGTCCGGCACGGACGGGGGAGAGCGGGGACCCCGCAAGGGCGGTCTGTTCGAGAAGCTGCTGGGGAG
GGAGGTCGAGGCGAGGGCAGCCGAGGCGGGGGCTTCGGGGAGCGGAGGCCTGCTACCG
GTTAGTTTGTTTTTTCTTCGTTTTCTGCACGTGCACCGAATAGACAATTTTCTTATGTGGTC
ACCGAATAGGTACTTCACTTCGTGCGGCCGATTTTATTGCCGTACATACCGCGAAAAATACAAGTAAGTTTAGTCCGCTCGCCGGGTGACGGCTAGGCTAGCGTCGCTTCACTATTCGCT
GTGCTGTCTACTAAGTCTGCATCTCGGTACGCGATAGACGTAGCAGAGGGCAGCGGATATGACCACTGATGCCTCTGCGATCAGGAGTGTGTTAGAGGAGGCGTGTGTTCAGGTGTCGGG
TGGCGATGGTTGGCATGTGAATATTGATCCGGACTAGTCGTTTGTTGCGAAAGGCTAGCCGCCCATGGTCACGCGTGCTGTTCTTGGAACACCGTTCAGAAGGCAACGAAACACAGCGCG
CAATAACTCGGCTGATCTCTTACCAACACGGACTGCTGTGGTCATCGTCGTCTGAAGGGCGGCATTTCTTCGCCAGCCGTGTTGGAAAGATTCCGAAAACAAACAAAGGAAATCCGATAA
GGGGAGATGAACGCCTCCCTCCCCCGCCGTCGCACCAGAAAGTCTTAATTTTCGGATATTCACGAGAACACAAACCCCATGCGACAGCCGCCTTCGGCCTCGGCTAGACCATATAGACCG
GTGGACTCAATCTCGAGAGAACTGAAGTAGCACGCGCCACCGAATACCGTAGGCTGCGTGAGTTATACCACATGTCACACCGCTGGACCGATTTTTCAAGGTCCGATTTCTCTGCTGCAG
TCTAGCAATGGCGCCGGAAATGATGGCGGTGGAACCGTGTTGTCGAGAGCTTTCCGAAAAAGTATCATTTGATTTTGGCGTCCTGTCACGGTGGAGTTTTTCGAGCTGAACAATCGGTAC
AGGGGGGGGTGGTATTTTTGGCCAACCTAGCATGCGGTAGGGTCACTGGTGACGCGTTTCGAAGTACAAGAGGGTTTATTTGCCATGTTGTTCTTTGTCAGATTCCAGACTAAAGGGCAG
GCTCGGAAGGCTGCTTTACGTTCGTCATTTTTGTTTACTTTCCCTTGTTTGCTTTGGCAGCAAACATGGAATGCAGATAAGTTGCCAGTGACTCGCACCAATAACATGCATGGAAAAACT
GGACGCATAACGAAAAGAGAGCCCGATCCTTCCAGCCTTATCCACACAACCGTACTTCCGGTCATATCCCGCCCGCAAATCGATCCAACCGCTCTGCAGGCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATACGGCCGACGTGTGCCGCGGGGAGCAATCAACGCCAGGATGGGTGCGCCTCGCTCAAAGAAACTTGGCGCGCGTCCGTGTCGGCGATCGGCTTCCCGATTCGATCGTGAGGCGT
CTCGACGATGACGGCATCGTGAAGGAGTTTTCGATCAGAGACGTCTTCGCCGGAAAGAAAGGAGTTCTAGTAGGCGTTCCGGGGGCGTTCACGCCCACCTGTTCGGCCGTCCATCTCCCC
GAGTTCGTGGACAAGTCGGGAGTGCTCGCCGCGAAG
GGTGCCGAGCTCGTGGCGTTCATTTCCGTGAACGATGCGTACGTGATGAAGGCGTGGGAGGACAGCCAGCAGGCTAAGGACAAG
GTGCTCATGCTCGCGGACGGCAACGGCGACCTCTCTGCTGCG
CTGGGCATGATGGTAGACCTCTCGGCGCAGGGCATGGGCCCCCGGTGCAAGCGCTTCCTCTGCGTGGTCGAGGACGGA
GTGGTGACGCACACCCGGATGGGCGACACGGTGGAGCTGGTCTCGGCCAGCGCGGTGGAGAAGGTGCTGTCCGGCACGGACGGGGGAGAGCGGGGACCCCGCAAGGGCGGTCTGTTCGAG
AAGCTGCTGGGGAGGGAGGTCGAGGCGAGGGCAGCCGAGGCGGGGGCTTCGGGGAGCGGAGGCCTGCTACCG
GCGTAA

Retrieve as FASTA