Entry information : EsilGPx01 (Esi_0152_0008)
Entry ID 16930
Creation 2021-01-29 (Christophe Dunand)
Last sequence changes 2021-01-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: EsilGPx01 (Esi_0152_0008)
Name (synonym) EsilGPx01 (Esi_0152_0008)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2006]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value EsilGPx01
start..stop
S start..stop
EsilGPx02 317 8e-113 1..176 1..176
EgrGPx05 171 2e-55 17..175 9..165
MdGPx06 171 2e-55 9..175 1..165
SpGPx01 171 3e-55 9..175 1..165
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 38446..38480 35 N° 2 34067..34188 122 N° 3 33437..33540 104 N° 4 32348..32374 27
N° 5 31778..31923 146 N° 6 31195..31291 97  
complement(join(31195..31291,31778..31923,32348..32374,33437..33540,34067..34188 ,38446..38480))


exon

Literature and cross-references EsilGPx01 (Esi_0152_0008)
Protein ref. GenBank:   CBN78848.1
DNA ref. GenBank:   FN648082.1 (31195..38480)
Protein sequence: EsilGPx01 (Esi_0152_0008)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   175
PWM (Da):   %s   18595.41  
PI (pH):   %s   4.47
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MCSPGGKLFGGGAPATSIFDFKVKDATAGEVDLADYKGQKKAFLIVNVASEGLTAQNYAELAALYGKYAGLGLEILGFPSNEFASEPGTNAEIQDFAKARGATYPVFAKVEVNGFGAIPLYKFLKDRQGGGLDISAIKWNFAKFLCDADGVPVKRFDPNESPFSFEQDIVDLLK

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGCAGCCCAGGGGGGAAGCTGTTCGGGGGCGGGTGAGTTAGCGGTTCAACCCTTACACTGACCTCCCTGGGGGTGAGCTTTGTATTGACACGCGCACGACGATGTGTTCCTGGGCAT
ACTCACGGTGTGTTGTTGGTTGATCTAGTCAATCTCAAGTGTATTCGTAGACTACATACAACGGCGGTCCTGATAATACAACAGAGCAAGCAGCAGTAGTCTGGAGGGTTCACTTGTACG
CATCATGCGCATGGGGGTCCAGAGACAAGGGCTTTTGACACTGGCTCTTTCCCATCCTTCAATCCTATACAAAGAAATAAAACAACCTTCTCGCCAGGGTTAGGTGGTGCATTCTACTGT
CATCATTAGAAGACACCATGAAGAGGCGTCGTGCGTGCTGACACGTTCAGGTTTGCTACTGGAGCTGAAATATCGAAGGTCGCAGCAGCCTTTGAAATCAGTCAGAAATCTGCGCCGGAA
CCAAGCGGGCATCCAACATTGGTCACAGCCGTGCTCACCGCCACGGACCGTAAACCCCTGAACGGAGGGTGTCAGCAGTAGCATCAGCTACTGTTGTAAACCCACAGTTCAAGGGATTGG
TGTCAGTGGCGGCGAGCACGGCTGTGACAAATGTTTGATGCCGCAGATTTCGGACTGTTGGCTGCTGCGACCTTCGATATTTCAGCTCCAGTAGCAAACCTGAACGTGCCAGCACGCACA
ACACCTCTTCACACGATGTCCTCTACTGATGACAATAGAATGCACCACCTAACCCTCAAGGCTGACCTTATTTGAGCGCCTTCCATTTTGACTGTTGACTTGAATGTAGCATCGTGTGAA
TTTTATCTTGATTTCAAAGGAGGAGTGTAGAGGTAGACACGTGAAAATGTAGTTTTGAGCAGCCTCTACTGCCGCCCTGTGCGAGAATAAACGATTTCTGTTTTTCGCGATGCCTTCCGA
CTGGTCTTGTTTTGTCTCTTGTGCATTTTCTGGTGCTCTTGCGTTTGTTTTCAAAATTAGTCAACACCGGAATTCCTTGTCTTCAGACCCTTAACAGCGGCGGATAGGCTGTCTGCGTGC
TGTTTCTGACCTCAGCCGACTCTAAACAGAGACAATTGTCAGTGATTCACACCGGGGGTTGGAGAGCAGAGTACCGTAATAGTCGGAGAGATGGCACCGGGTGCGATCGTTTTTTTATGT
TTTTTCCTCGTTTTTTTTTATCACACCCCTGTGCCATCTCTCCGACCCCGGTGCGGAAATGCAATTTAAGTCAGTCCGTTTATAGTATTTTCAAGGCACCCCGGTGCGATCTCTCCGACC
GGTGCGATCTCCGATGAAATACACACAGGTGTTGTACGCACGCACACCGGTGCCATCTATTTATCTGTACTACAGTATTGATATCAGCATAGAACCACGTGAGGCACCGTCGCTGGTTGG
AAGCACACCGGTAACAGCAACGTAGGCTGGTACGCTTTCCGTGCAGCGAGTGGTCTTATGTTTGATGCGAGTTCGGCTCTGGCTTGACGACAACAACAACGTCGTTTCCGTCTGAGGTAC
CGGTACATACGGTATCAGTTGTCTCCCGCTTTCGTTTCGGGCTTCCTCTACGGATACCAGTACGTACGCAGCAGTACATACTGGTAGTTTTTTCGTGCTGTGCAAGGTGGGGTAGGGTGT
GGCTTGCGCGTTGTGTGTTTCGTTGAATGTACAATGGGCAACTTCCAACCAGTTAATAAATGAAAACAACTAGCATCCCGCGTGAAACTGCGACCATGCATACGTACATACAGGAGTGGC
GCCCGCTGACACCGACCGCACATGTAAAAGGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNCTCCGACCCCGGTGCGTAAATCGAATTAAATCATGCCGTTCTGGTATTTTCCTGCGCACCCCGGTGCCATCTCCCCGACCGGTGCCATTTCTCGGACCGGTGCCATC
TCTCCGACTATTACGGTATGTATACGAACAGCGTATCCACAGCTGGCTTGTAGTGACATGACTAATGCTGACGCAGTACCTTGTTCCCTCACACAGAGCTCTTCGACCCACGTTTGAGCA
CGGCGATCTTTTGTGCATGAACGAGCAGAAAGTTGCTGGCCGTATATCTCCGTTTGACGTTCATGGTGCACCGCCGTCCATTCCTCTAGGAGGCCGATACGGTCTCTAGAGGTCTCACAC
AACGGTAAAAAAAAGTGTCTGTCTGTCTGTCTGTCTGTTTGTCGCCGTTCACTCCGAAGCTCCGAACCACGCGCTTTTTTCACCCGAACGCCCACGGCGCGAGGAATCAGACCATCGGCC
GTCCTGCACTGCTTGAGATGCCCTCAGCAATTTTCAGCTTGATTGGCGCCTCCTGCGTTAACGTGGCTGTGTCGTTGAATGGCCTTTCAAGCACGAAAAACGAGCATGCAGCAGGTGCTT
CTGGCGTCAAATTGCTACGATCTCGATGAATTTGTGCCTGGATGTTGCCTATCCTGCACCAAATCGAAGCCCCGTCCAATCTACAGCTGGATTCACAAGTCCCTCGACGCTGGAATTGCT
GTGTGCCACCAATTCAACGAGAGGTTCGGGCTGCACCGCTGCAACCTTCCGACGCGGAGTTCCTTCCGCCGAATGTTGCACGCACACCACAAGTTGATGACTGATGACTCTCTCTTTTGT
CGCCGGAACACATCATGATTAGACTATCATCCGTCCATACATCCATCGTACAATAACTTCGATCTCGACCAATTTGAACGTGCGTATATATAGTGACCTCCCTACTGCCCGGGATGACCC
TGCCAACGACAGGGTCGAGGCACACATCTGTCACCTGCTCAGCGGAGACACCGCTGCCACTCTGCCACCTTCTTCGCGGAGGATGTTCCGCCGCATTTCGACAGCTACTCTTTTGTTCAA
CGGCGCGCGCATAATACATACTGGAGTAATTGTTGTTGATTACTGGAGTACTTCGTTCTCGTCTGAAGACACCAATCAATACATTGGAGTACCTTCAAGTGGTACGCAATGTACACGCAG
TTCACATGCACGGCCGCCTGCAATGCACCTGACAGCCATCTGCAACGGTCGTGACCTATTGTACATACATGCGGCGACGACGCTGCTGCAGCAACACCAATCAATTGGTCCGAGGATGAA
AGTGTCGTGGCCCTTTTCGAAACGAAAACGCTTTTGGGAGCGTTTTGCTGGGGAGGAAATCAACGAGCACCCGTGAAGCTACGATTCAATTGGAAGCCTTCATGGAGTGCCTATGATCTC
TTGCCTCTCAGCAACAAACTTCCAAGCTTCGTGAGGCAAAACAGAATACTGTAGTAGTACATAAGTAGACAGTAATTCCACCACCCTCCCCCCCACCACCATCAGCACCGCCGCGCAAGA
GTGCAAGCCTACAGTCTGCACGGGCCGATTTAGAACGTCACCTACCTTCGCGAACGTGGATTGCAGCTTTTTGTCGGACAAGTGAATGAGTATCTTCCTTCCTTGCTTCTCCCCCCTACT
AATACTGTTCTTTTCTTGATCGTTACAAACTTTGTCAAACCCCAGCGATATATAATTGGGTATCTTGCCCTTTTCGGTCGTCTGAACGGACGTGTTCGTCCTGCTCAGCACGCGGCCGTT
CTCCTCCTCGGTATCATCCACACAAGGCCACGGGATCCAACAATCATGCGCACGTTCGCGCACCGTGCTTTCGGTTCTTGCTGTTCTAGTCCATTCACGGTAGGAAGTGATGGCGTTGAA
CTGTATCTTCACCAGCAGAGTCCGCCGCAGCGGTAGAGTGCGCGGGGGGGAGGAACGATGAAAGCTTCTTGTCTTGTCAAGTGCAGCCCCAAGCTGTTGTGTGGTAAGTGGAAGACTTGC
TCTTCACATCCGCCGTCTAGGGCTCGGCGGGAGATGCAAGTCGTGTGCTTCAACCTCCGGTTGTTCGGACGATTTTCAACCACCTGTTCAGCCTTTACAACCAATTTTTTAAAACCGAAA
TCACACCATCAGAAGAGTCAGCGCTGACTAGTCTAATGGTTTGATTTCGGATTCTGAAAGCCGCAATTGCACACACGCAAGATGGCATGTTTTAAGATCCTGGTTGCGCTTTTTCGACGA
AGGAAAGCGTCGTTCGTTTGCTGCTGGATCAGCGCTCGCCCTTTCTTGTTGGTTGCCACGCGCTCCCCCCCCGCCCGGCCTGTCTTCCTCAGGGCACCCGCCACTTCAATCTTCGATTTT
AAGGTTAAGGATGCTACCGCTGGCGAGGTAGACCTGGCCGACTACAAGGGTCAGAAGAAGGCGTTCCTCATCGTCAATGTGGCGAGCGAATGAG
GTATCTATTGTTTGCTGGGGCGGTGG
ATAGTGTGGCGTATTGTGTGAAACATAAAGTATAGGATAAGGTGTGGTTGAGGTATTATTGTATCGTTGGAAATGCAGATGGTGTGGCGAGCAATATGAGGAGGTGTTGTGTGCTTTTGA
CTACGGACTTGGCGTGTTTTTGTTCCATCGCGGTGCACTACTGGTGTAGCTGCACAGGTCTTTTTTTTTCAACACTGCCCGATGGCGACTGGGAGGGCGAGACTTGTATCTCTGCCGGCC
CGTTTCCCGCCGGTTCACATTCGTGCATCTAATATTTTCTTGTTTCGCTGCGCTTCGTTGAAATCACAATCGGGGGAGGCCAATCACCAACTGCTTGCGTGTTCCCCCGATACAAGTATC
TTCCCACCGCAGTACATGCCGCGAACGAACGTGTGGTGAAGCATATCTCCCCCGTCACGCCTTCACTTGCCTGACAATCTCTTCCTCTTGACCTTGTGTTCCACCCCCCGACTTTTTCGC
GACGTTTTCTGCTCCGAAAGGTCTAACCGCCCAGAACTACGCCGAGCTGGCGGCTCTCTACGGAAAGTACGCCGGCCTCGGTCTGGAGATTCTGGGCTTTCCTTCGAACGAGTTCGCTTC
GGAG
GTACACACACGCATACAGCGTCTTTTCGTTCTTTTTGTGCTCTTGGTTTTCCTAACGCTGACTACAGCAGTGTCATTTTTTTTTTTTTGTGTCGTTGGTGATAGCAACGGACCCTC
CATGAGGAAACATTGGAGCTTCACCAGGCTACGTGTCAATCTTGGTCGCCAGGGGGGGCGGGGGGAGGAGTCCGTACACGTTTGCGGGGGGTGGAGTTTTGACCAAATCCCCGTGGTTTC
GACATTTATTGCGCGCTTTTTTCAGCGCACGCGCGCGGGATCCCACACCAAGCTAGTTAAAATTCTGGAATACCCTCTGGCTTCGCGTCAATCTTGACCGCGAGGGGGGGGGGGGGGGTC
TATTGTATGGTATAGGAATAAGTATGACGATCCTAAAATAATAAGGAGTATGTTATGGGTTTTAGAATGCGGCACGAAAGCCTATACAATGAAGTGTATATTGGTTTTGCTATTGACAAA
CTAAATCCTATTCAGTAGACTGCTGCAAGTGAGCGGCGTAATGTGGCTACCCCACGTGTCCATCTTTGTCTGGGGGGGGTGGGGGGGGTGTTCCATGGTTTCCACATGAAGGGCCTCTCG
GTGAGAGAGATGCCCCTTTGTTTACCCTCCCCGAACCCGCGAAACCGGTCCGATTGTCTTATTTTCGGTTGTTGGTCATTCGCTTTTCTTTCGTTCAAAGGGGCTTTCAGTTCATCCAGA
TCTTGTCATTGCCATTCGCTTTTGTTTTTGCTTAAACGTACATAGCTCGTGAATATCTTTTCTCTTTTCGTTGGAATTCGGGCTGTACTATGTTGTGCGTACAATGGTGCACATTGCCAC
ACATAATCAAGTTGGACACTGTTGCTGTCGAAACGTGAGTTGCATGATAGACTACCCACAACAGGCTCCGACTCGAACCTCGGCGTTCGTCGCCATTCTCTCCGCTTCCCTCTACCCTTC
GTCTCTTTTATCGTCCCAAACTTTGCGCCTCTTCTGCTCGTGCCGACTGTTTTTCGCGATGGGGCGTCATTTTGTTCCGGTGCGGCTGTTTCGTTTCGAGAAACAGGAACCAGGCACCAA
TGCCGAAATCCAG
GTGGGCACGTCACCTTGGCCGCGCCATGATGAAACAGTGTCCGACGCTGCCTGTTCACCAAGAGTCGCTACATACAATTCCGATTGCACGATGATTGCTCGCAGGTT
GTCTTGATAGCAGCAGTATCCTTCACAAGGAGTTTAAGCTAGGGCATAGTAGGGGGTACGGTGTTGGGTTAGGGTTAGGGATAGCCCCCCCTTTCTATTTCATAGATCAACCTAAAGTCC
TCGCAGGGGTGATCCTGTCTCGACCGGTGGGTGTCCCGTCGCGTGCGGAAGAGGTGTGGCGTATGCGTATGAGCTGTAGCTTTTCTGTGAACCACGGGCCTCCTGTGTGTCTTTTTTAAC
CTTGCCTGTTCCACGCACGCGTGCGCGTCCCCGTACCTGCTGCTGTCGCGACCGAAACGCTCGCGCCCGTCGGCCAGGACTTTGCCAAGGCAAGGGGTGCGACGTACCCCGTCTTTGCCA
AGGTCGAGGTGAACGGCTTCGGCGCCATCCCCCTCTACAAGTTCCTGAAGGACAGGCAGGGCGGGGGCTTGGACATCTCCGCCATCAAGTGGAACTTCGCCAA
GTGCGTCCGTCCGCGGC
GTTGTGTATCTGCCACCTTGTATCGCAACAGCGATTTGGGAGGATCTGGCGCTGAGTGCTGGGAGCCACGTGTTGGTACAAGTACTCCCCCGGGTCCACCTTATCAAGAGCCTTGGTGCA
ACTTTGGCTGGAACTTGCTTCCCCAAATTTGTGTATTTGGTGTGCAGAATAGTCCATAGGGAAGCGCGTGCTGGTTCTGGCATTGCTGTCGTCGTCTGCAAACGTTGTTTTCTCGGCCGG
GATGCAGTGTCTGGACCAAACGAAGCAACCGTGAGCCTCCACAGGCATCATGTACTGTGGAGGGGAAGCATGTTGTTGTCCCAGTGTTGCCGGTTCCGGTTCTGCAAATCAGCAGTTTGT
TTCGTTGGCGCGGCCGCGAGATTGACCACACGCTGTCCGCCCCCGTGCGTGCGCACTATCCCACCCCCGAACCCCTTCGGCCCACGCGCGGACCCCGAAACACAATCAGGTTCCTCTGCG
ATGCCGACGGAGTGCCGGTGAAACGTTTCGACCCCAATGAAAGCCCGTTTTCCTTCGAGCAGGACATCGTCGACCTCCTCAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGCAGCCCAGGGGGGAAGCTGTTCGGGGGCGGGGCACCCGCCACTTCAATCTTCGATTTTAAGGTTAAGGATGCTACCGCTGGCGAGGTAGACCTGGCCGACTACAAGGGTCAGAAG
AAGGCGTTCCTCATCGTCAATGTGGCGAGCGAATGAG
GTCTAACCGCCCAGAACTACGCCGAGCTGGCGGCTCTCTACGGAAAGTACGCCGGCCTCGGTCTGGAGATTCTGGGCTTTCCT
TCGAACGAGTTCGCTTCGGAG
GAACCAGGCACCAATGCCGAAATCCAGGACTTTGCCAAGGCAAGGGGTGCGACGTACCCCGTCTTTGCCAAGGTCGAGGTGAACGGCTTCGGCGCCATC
CCCCTCTACAAGTTCCTGAAGGACAGGCAGGGCGGGGGCTTGGACATCTCCGCCATCAAGTGGAACTTCGCCAA
GTTCCTCTGCGATGCCGACGGAGTGCCGGTGAAACGTTTCGACCCC
AATGAAAGCCCGTTTTCCTTCGAGCAGGACATCGTCGACCTCCTCAAGTAA

Retrieve as FASTA