Entry information : EsilGPx02 (Esi_0152_0006)
Entry ID 16931
Creation 2021-01-29 (Christophe Dunand)
Last sequence changes 2021-01-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Peroxidase information: EsilGPx02 (Esi_0152_0006)
Name (synonym) EsilGPx02 (Esi_0152_0006)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2006]
Taxonomy Eukaryota Phaeophyceae Ectocarpaceae Ectocarpus
Organism Ectocarpus siliculosus    [TaxId: 2880 ]
Cellular localisation N/D
Tissue type
Inducer
Repressor
Best BLASTp hits
Perox score E-value EsilGPx02
start..stop
S start..stop
EsilGPx01 317 8.58e-113 1..176 1..176
EgrGPx05 188 6.58e-62 17..175 9..165
MdGPx06 186 1.94e-61 10..175 2..165
SpGPx01 186 3.82e-61 10..175 2..165
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '16931' 'join(21018..21052,22804..22925,23461..23564,24205..24231,24651..24796,25300..25396)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21018..21052 33 N° 2 22804..22925 120 N° 3 23461..23564 102 N° 4 24205..24231 25
N° 5 24651..24796 144 N° 6 25300..25396 95  
join(21018..21052,22804..22925,23461..23564,24205..24231,24651..24796,25300..253 96)


exon

Literature and cross-references EsilGPx02 (Esi_0152_0006)
Protein ref. GenBank:   CBN78847.1
DNA ref. GenBank:   FN648082.1 (21018..25396)
Protein sequence: EsilGPx02 (Esi_0152_0006)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   175
PWM (Da):   %s   18510.47  
PI (pH):   %s   6.65
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MCSLGKLFGGGGAPATSIFDFKVKDATGGEVDLADYKGQKKAFLIVNVASKGLTAQNYAELAALYGKYAGRGLEILGFPSNQFGSEPGTNAEIQDFAKARGATYPVFAKVEVNGFGAIPL
YKFLKDRQGGGLGISAIKWNFT
KFLCDADGVPVNRFGPTESPFSFEQDIVDLLK

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGCAGCCTGGGCAAGCTGTTCGGAGGAGGCGGGGGTGAGTCAGCGACTGACCACTGGGCGTGAGCTTAATAATGAATAATATGACCCGTAAAAATGCGCACGACCGTTGCCGCTGAC
ATGCCCCTCGGCACACCCACTTGTTGTTGGTTGATCTGTTCGACCTAGAGGTATTTCAGAGTGAGACCCGGGAGCGTTGTGTAGGCTGTATTTAGACAGTCTAAGCTCTGGTAAGTTGTC
AAGCCTAGACTCTATGACAGCGGGGTAAAGGCTGTGTCCGTGCTGTTTCTGACCTCAGCCGAAGAGAGACTGCTGCGTTAGTGATGCACACCTAGGGGTGGAGGAAATCTGCTACTAAAG
AACAGCCTATCCACAGTTGATGTGTAGCGACATGACGGATGCTGACGCAGTGCCCTTCTCCCTCACACATGGAACTCTTCGACCCACGTTTGAAACGCGGCGATTTATTTTTTCCATGTG
TCAACGGAGACCGTTGCTGGATTACTCCGTTTTGCCGTTCACGGTTCACCACCGTCCATGGACGTGCCTTGTTGTACATACATCATGCACTCCAACACATCCCGTTCGACTGCTGTGGTT
TTATATCTCGAACGGGTAGTTTTGCTGCATGCCTACAGTAGTTGTATTTTTTTTTCCTGATCATGTCTGACGCCTTTGATGGTACCCTGCAAGTGGTGCGCAAGGTACATGCACGGCCAC
CTGCAATGCACCCGACGCCCACCTCCAACAGTCGCTACCAATGCACATACATGTACATGCGGCGACGATGTACTACTTCTGCTGTGAGTGCAGCAACACCAATTGGTCCTGGGATGGAAG
TGTCGTGACCCTTTTCGAAACGAAAACAGGTGTGGGGGCGTTTTGCTGGGGGAAGTCAGCGAGCGCCTGTAAAAGCGATGATACAAACACAAGCCAAGACGCCTCTATCTAGCTTTTGTA
TGTACCCCAAGCTCTGCCTCCAAGCAACAAATTTCGCGTCGTGAGGCCAAACACAACGTAAGTAAACTGCTGTGTAGTGGATTACAGCTTTCTGGTCGCACAAGCAAATGTGTATCTTCC
CTCGACGTCACCTCCCGACTACTGTTCTTGGTCGTTGCAAACTCTGTCAAAATCCCGAGCGATGTACAATTGGGTATCTTGCCCTTTCGGTCGTCTGAACGCATGTGTCCGTGCCATTCC
GCACGCGACCGTTCTCCTCAGCGACGTTCCACACAAGGCCAGGGAAGACAGCGATCATGCGCACATTCGCGCACCGTGCTTTCGGCTCTTGCTGTTCTTCTAGTCCATTCACGGGAGGAA
GTGATGGCGTTGACGGGGTATCTCCCCCAGCAGAGTCCGCCGCAGGGGTAGAGCGCCCGGCAGGGGGAAACGAAGACCTCTTGTCTTTTCCAGTGCAGCCCCAAGCTGTTGAGTGGTAAG
TGTAGAGACTTGCTCTTCACGTCCGCCATATTCGGCTTGGCGGGAGATGCAAGTCGTGTGCTTCAACCTCCGGTTGTTCGGCCGAGCGTCAACCACCTGTTCAGCCTTTACAACCAACGT
TTTTAGAAGACAAATCACACCATCAGAAGAGTCAGCGCTGACTAGTCTAATGGTTTGATTTCGGATTCTGAAAGCCGTCCAACAGCAGACCTCAGATGGCATGTTCTAGGGCCCTGGCTG
TGCCTTTTCGACGAAGGAAAGCGCCGTTCGTTTGCTGCTGGATCAGTGCTCGCCCCCTTACTTATTGGTTGTCACGCCCTCCCCCACCGCCCGGCCTGTCTTACTCAGGGCACCCGCCAC
GTCCATCTTCGATTTCAAGGTTAAGGATGCTACCGGTGGCGAGGTAGACCTGGCCGACTACAAGGGTCAGAAGAAGGCGTTCCTCATCGTCAATGTGGCGAGTAAATGAG
AGGTATCTAT
TGTGTGGGCGACGGATAGTGTGGCGATATTGTGTGATACATCAAAGTATAGGATAAGGTGTGGTTGAGGTATTATTGTATCGTTGGAAATGCAGACGATGTGGCGAGCAGTATAAGGAGG
TGTTGTGTGCTTGGACTACGGATGTGGCTTGTTGTTGTTCCGTCGCGCTGCACTACTGGTGTAGCTGCACAGGTGCTCAACCGTGCTTTTTTTTTCTACACTGCCCGATGGGGCGAGACT
TGTATCTCTGATGGCCCCTTTCCCTCCGGTCCACGTTCGCACAAATGTAATCTGTTCTTCAAGACGCGCTCTTTGCTGCGCTTTGTTGAAATCACAATCGGGGGAGGCCAATCACCAAGC
TGCTTGCGTGTCCCCCCGATACAAGTATCTTCCCACCGCAGTACATGCCGCGAACGAACGTGTGGAGAAGCATATCTCCCCCGTCACGCCTTCACCCCCCTGGTGATCTCTTCCCCTTGA
CCTTGTTCCACCCCCCGACTTTTTTGCGACGTTTTCTGCTCCGCAAGGTCTAACCGCCCAGAACTACGCCGAGCTGGCGGCTCTCTACGGAAAGTACGCCGGCCGCGGCCTAGAGATTCT
GGGCTTTCCTTCGAACCAGTTCGGTTCGCAG
AGGTATATGTGTTCATGCGTCTTGTCGTTCTTTTTGTGCTCTTGGTTTCTCGTCGATGGCTATTGCTGTGTAGTTTTTCTCTTTGTATA
TCTTTGTGAGACCGGTTCGCGGGTGCATGCATGCGTGTTCTATAGTAGTTATTTTTTGTGCTCTTGTTTTCCCTCTCGATGTCTACTGTGCTGTGTTTTTCTTCTTTCGAGTGTCTTTCG
TAAGAGAGGCATCTCTCTGTTCCCCTCCCCCAACCCCCGAAGCCATTCCGGATGTTTTATTTTCGGTCGTTGGTTGGTTATGCGCTTTTCTTGCGTTCAGAGGGGCTCCGTCATCCAGTG
CTTGTAGCTTATTCATAACCTTTCTCTGTTGGTTGGAGTTCGGGCTGTACTATGTTGTGCGTGCAGTACAAATTACCACGCACAATCAAGTTGGACACTGTTGCTGTCGGAACGTGAGTT
GCATGATAGACTACCCCCAACAGGCTCCGACTCGAACCTCCGCACTTGTCGCCATTCTCTCCGCTTCTCTCTACCCTTTGTCCCTTTTATCGTCCCAAACTTGAATTTTTTGTGCCTCTT
CTGCTCGTGCCGACTGTTTTTCGCGATGGGGCGTCATTTTGTTCCGGTGCGGCTGTTTCGTTTCGAGAAACAGGAACCAGGCACCAATGCCGAAATCCAGAGGTGGGCACGTCACCTTGG
CCGCGCCATGATGAAACAGTGTCCGACGCTGCCTGTTCACCAAGAGTCGCTACATACAATTCCGTTTGCACGATGATTGCTCGCAGGTTGTCTTGATAGCAGCAGTATCCTTCACAAGGA
GTTTAAGCTAGGGCGTAGTAGGGGGTACGGTGTTGGGTTAGGGTTAGGGATGGGCCCCCCTTTCTATTTCATAGATCAACCTAAAGTCCTCGCGGGTGTGATCCTGTCTCGACCGGTGGG
TGTCCCGTCGCGTGCGGAAGAGGTGTGGCGTATGCGCATGAGCTGTAGCTTTTCTGTGAACCACGGGCCTCCTGTGTGTCTTTTTAACCTTGTCTGTTCCGCGCGTGCGCGTCCCCGTAC
CTGCTGCTGTCGCGGCCGAAACGCTCGCGCCCGTCGGCCAGGACTTTGCCAAGGCAAGGGGTGCGACGTACCCCGTCTTTGCCAAGGTCGAGGTGAACGGCTTCGGCGCCATCCCCCTCT
ACAAGTTCCTGAAGGACAGGCAGGGCGGGGGCTTGGGCATCTCCGCCATCAAGTGGAACTTCACCAA
AAGTGCGTCCGTCCGCAAATCGCGAAGGCCGTGCCCTACGCGGCGTTGTGTCG
CAACAGCGATTTGGGGAGTGTCTGGCGCTGTGTCGTGGGAGCCACGTGTTGATACAGTACTCACCTGAGTCTACCTTATCAAGAGCCTTGGTGCAACTATAGCTCGAACTTGCCTATTCT
AATTTGTGTATTTGGTGTGCAGAATAGTCCATAGGGAAGCGTGTGCTGGTTCTTGCATCACTGTCGTCGTTTGCAAACGTTGTTTTCCCGGCCGGGACACAGTGTCTGGACCAAACGAAG
CAACCGTGAGCCTCCACAGGCACCATGTACTGCTGTGGAGGGGAAGCATGTTGTTGTCCCAGTGTTGCCGGTTCCGGTTCTGCAAATCAGCACTTTGTTTCGTTGGCGAGGCCGCGAGAT
TGACCATACGCGGTCCGCCCTACCGTGCATGCGCACTAACCCCCCCTCACACACACATCTCGGCCCACGCGCGGACCCCGAAACACAATCAGGTTCCTCTGCGATGCCGACGGAGTGCCG
GTGAACCGTTTCGGCCCCACGGAAAGCCCGTTTTCCTTCGAGCAGGACATCGTCGACCTCCTCAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGCAGCCTGGGCAAGCTGTTCGGAGGAGGCGGGGCACCCGCCACGTCCATCTTCGATTTCAAGGTTAAGGATGCTACCGGTGGCGAGGTAGACCTGGCCGACTACAAGGGTCAGAAG
AAGGCGTTCCTCATCGTCAATGTGGCGAGTAAATGAG
GTCTAACCGCCCAGAACTACGCCGAGCTGGCGGCTCTCTACGGAAAGTACGCCGGCCGCGGCCTAGAGATTCTGGGCTTTCCT
TCGAACCAGTTCGGTTCGCAG
GAACCAGGCACCAATGCCGAAATCCAGGACTTTGCCAAGGCAAGGGGTGCGACGTACCCCGTCTTTGCCAAGGTCGAGGTGAACGGCTTCGGCGCCATC
CCCCTCTACAAGTTCCTGAAGGACAGGCAGGGCGGGGGCTTGGGCATCTCCGCCATCAAGTGGAACTTCACCAA
GTTCCTCTGCGATGCCGACGGAGTGCCGGTGAACCGTTTCGGCCCC
ACGGAAAGCCCGTTTTCCTTCGAGCAGGACATCGTCGACCTCCTCAAGTAA

Retrieve as FASTA